BLASTX nr result
ID: Mentha23_contig00046504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046504 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523528.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002523528.1| conserved hypothetical protein [Ricinus communis] gi|223537235|gb|EEF38867.1| conserved hypothetical protein [Ricinus communis] Length = 472 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +3 Query: 129 YVGTQGTCSIPYVYTQEDMMS-NGQIIRTLHVDGTYNGVSLYDFKFQ 266 YV T+GTC+IP+ YTQ D +S +G T HVDG Y GV+ Y F F+ Sbjct: 419 YVATRGTCNIPFSYTQRDRLSHDGSFATTQHVDGVYTGVNYYSFHFE 465