BLASTX nr result
ID: Mentha23_contig00046496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046496 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523528.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002523528.1| conserved hypothetical protein [Ricinus communis] gi|223537235|gb|EEF38867.1| conserved hypothetical protein [Ricinus communis] Length = 472 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/57 (45%), Positives = 32/57 (56%) Frame = -3 Query: 343 VPAKSRGVVSYEGTTVTCKVPFYYHQRDKSSIDEKIIESDQFDGFYIGINSYDFKFE 173 VPA+SR + Y T TC +PF Y QRD+ S D + DG Y G+N Y F FE Sbjct: 409 VPARSRIRIDYVATRGTCNIPFSYTQRDRLSHDGSFATTQHVDGVYTGVNYYSFHFE 465