BLASTX nr result
ID: Mentha23_contig00046326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046326 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial... 41 4e-06 >gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Mimulus guttatus] Length = 690 Score = 41.2 bits (95), Expect(2) = 4e-06 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = -1 Query: 342 LYYCPHNLGWDADFLHFPLLQNLCLRYLSKLNDL 241 +YYC + W+AD HFP+L+NL L LSKL+++ Sbjct: 588 IYYCYDLMHWNADRSHFPVLENLVLEGLSKLDEI 621 Score = 35.4 bits (80), Expect(2) = 4e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -2 Query: 233 GEIPTLKLIKLEYISESASISAMGKLVEQD 144 GEIPTL LI+L+ SESA+ISA+ L EQ+ Sbjct: 626 GEIPTLGLIELDGCSESAAISAVRILEEQE 655