BLASTX nr result
ID: Mentha23_contig00046247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046247 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43979.1| hypothetical protein MIMGU_mgv1a016899mg [Mimulus... 57 3e-06 >gb|EYU43979.1| hypothetical protein MIMGU_mgv1a016899mg [Mimulus guttatus] Length = 102 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/93 (36%), Positives = 57/93 (61%), Gaps = 7/93 (7%) Frame = +2 Query: 32 MAAKQDLAKIGKDGFLLLEDFINYSKGRNAAPRK-AYAPQ------RQGAEIGARLADFQ 190 MA+K+DL +IG +GF L+++++ KGR+AAP+K +YA + R+ + +Q Sbjct: 1 MASKEDLIRIGIEGFRLVDEYME-KKGRSAAPKKPSYATKQRPNFPRENINRQTCMYQYQ 59 Query: 191 PQQIPLYQIKPKVTNGEKMKM*EVVKFHDQVRV 289 PQ+ PL+Q+ V++ E + E V+F D V V Sbjct: 60 PQRAPLHQVIKPVSSNEIVNSYEAVQFRDGVSV 92