BLASTX nr result
ID: Mentha23_contig00046240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046240 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 60 4e-07 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 6/75 (8%) Frame = +1 Query: 226 GECEGEL------QSVIFNPMMGDFKFLPPSGVKRPEGSNLSIVTGCGFGFDPLREDYKV 387 G C G L ++ ++NP +FK LP S V RP + + GFGFD + +DYKV Sbjct: 110 GPCNGLLCLHDAGKAALWNPSTREFKILPRSSVNRPPSVDSTSFGCLGFGFDSITDDYKV 169 Query: 388 IRFVLNCFEKFDEKG 432 +RFV N F++ +E+G Sbjct: 170 VRFVTNYFDENEEEG 184