BLASTX nr result
ID: Mentha23_contig00046159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046159 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 70 7e-16 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 69.7 bits (169), Expect(2) = 7e-16 Identities = 43/113 (38%), Positives = 65/113 (57%), Gaps = 2/113 (1%) Frame = -2 Query: 350 LHLLEFDGLLGAIVYTEEYSSHSQEMSVFDGELWVWNNESWTRKFEIHFVGPWISQILGF 171 L LL+F+G LGAIVY E E S+ +LWV N SWTR+F I V + + LGF Sbjct: 266 LQLLDFNGSLGAIVYPRE----GTEKSI---DLWVMNG-SWTRQFSIESVS-GVERPLGF 316 Query: 170 SNDNHLFFHSQEYQLLMYEAGTQKLKKFDIYGYD--MEVFPYFDNKVDFDGRS 18 + LF S ++L++++ T++LK I+ Y M++ Y ++ V +GRS Sbjct: 317 WKNGELFLESSNHELVLFDPATRELKNLGIHAYQNTMQLIAYVESLVPINGRS 369 Score = 40.0 bits (92), Expect(2) = 7e-16 Identities = 27/64 (42%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -3 Query: 589 WKEIFEDPTHPYFTSDSLSNCLGNSCYANGCCYLETYKGN----ILSFDFATERFTSFPL 422 WKEI HPY S +N Y NG Y + GN ILSFD A E+F++ PL Sbjct: 203 WKEISVPEAHPY-ASPLFNN------YVNGSYYWQA-TGNSDYLILSFDMANEKFSTLPL 254 Query: 421 PNTG 410 P G Sbjct: 255 PTFG 258