BLASTX nr result
ID: Mentha23_contig00046069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046069 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41608.1| hypothetical protein MIMGU_mgv1a000472mg [Mimulus... 65 1e-08 >gb|EYU41608.1| hypothetical protein MIMGU_mgv1a000472mg [Mimulus guttatus] Length = 1130 Score = 64.7 bits (156), Expect = 1e-08 Identities = 47/132 (35%), Positives = 66/132 (50%), Gaps = 4/132 (3%) Frame = +2 Query: 8 SEAANDSHARMEQKPAKSCS-TEPQQHRSFLMGNARLSSSSK--ATKPPNLYMTGPISQD 178 SEA N S + P KS P + GN+ + +K + KP + GP Sbjct: 1000 SEAPNKSSPKPPSMPPKSNYWAPPTPYSPNQSGNSEQPTPAKVASNKPNKSNLPGPSQIP 1059 Query: 179 SAGKAHARIVQEYKPS-AKSFPTEEASLPQKKTEPYLKTEILKKDSSNQKPSHVHPKLPD 355 S+GKA + IVQ+ K + KS EE S Q+K EP + + K +K SHVHPKLPD Sbjct: 1060 SSGKATSAIVQDGKAAHKKSSAVEEPSSSQQKPEPSIDSP--GKQDGAKKASHVHPKLPD 1117 Query: 356 YDSFVQLFQKSR 391 YD+ + + +R Sbjct: 1118 YDTLFETLRANR 1129