BLASTX nr result
ID: Mentha23_contig00045742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00045742 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37212.1| hypothetical protein MIMGU_mgv11b022413mg [Mimulu... 75 2e-18 >gb|EYU37212.1| hypothetical protein MIMGU_mgv11b022413mg [Mimulus guttatus] Length = 515 Score = 75.1 bits (183), Expect(2) = 2e-18 Identities = 34/73 (46%), Positives = 50/73 (68%) Frame = -3 Query: 406 IDNPLRISKLTMIQRMARAKEVTLKYLKENQHILFEGVSYYFKGIVDKIENKSSIWYDAC 227 I++PL+I L M +R+ +A +VTL + N+ +L E Y+FK V+K+ENKS IWYD+C Sbjct: 248 INDPLKIQALAMKERIKKANKVTLHEIIHNRFLLSEDEYYFFKATVNKVENKSYIWYDSC 307 Query: 226 KKCDKSFPKNGVT 188 KC+ + KNG T Sbjct: 308 TKCNSAISKNGDT 320 Score = 43.1 bits (100), Expect(2) = 2e-18 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = -2 Query: 101 ARVTMFNEAAAVYVGCPINEYLSSISEE 18 A +T+F EAA +YVGCP+NEYL S+ +E Sbjct: 345 ALITIFEEAAMLYVGCPVNEYLMSVEKE 372