BLASTX nr result
ID: Mentha23_contig00045478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00045478 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529390.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 4e-07 ref|XP_007042389.1| Cyclin-dependent kinase inhibitor family pro... 58 1e-06 ref|NP_001235878.1| uncharacterized protein LOC100306496 [Glycin... 58 1e-06 ref|XP_007156548.1| hypothetical protein PHAVU_003G295400g [Phas... 58 2e-06 ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor... 58 2e-06 emb|CBI32432.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_004136985.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 4e-06 emb|CAC41621.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis... 56 6e-06 ref|NP_175385.1| cyclin-dependent kinase inhibitor 7 [Arabidopsi... 56 6e-06 ref|XP_002518785.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 ref|XP_002523560.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_003529390.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Glycine max] Length = 187 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRMH 240 FF AE+Y QKRFTEKY++DIV+D P L GRYQWVR+H Sbjct: 151 FFAMAEKYEQKRFTEKYNFDIVRDLP-LEGRYQWVRLH 187 >ref|XP_007042389.1| Cyclin-dependent kinase inhibitor family protein, putative [Theobroma cacao] gi|508706324|gb|EOX98220.1| Cyclin-dependent kinase inhibitor family protein, putative [Theobroma cacao] Length = 210 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF+ AE+Y QKRF EKY+YDIVKD P L GRYQWVR+ Sbjct: 173 FFSFAEKYEQKRFAEKYNYDIVKDVP-LDGRYQWVRL 208 >ref|NP_001235878.1| uncharacterized protein LOC100306496 [Glycine max] gi|255628711|gb|ACU14700.1| unknown [Glycine max] Length = 176 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRMH 240 FF AE+Y +KRFTEKY++DIV+D P L GRYQWVR+H Sbjct: 140 FFAMAEKYERKRFTEKYNFDIVRDLP-LEGRYQWVRLH 176 >ref|XP_007156548.1| hypothetical protein PHAVU_003G295400g [Phaseolus vulgaris] gi|561029902|gb|ESW28542.1| hypothetical protein PHAVU_003G295400g [Phaseolus vulgaris] Length = 191 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRMH 240 FF AE+Y QKRF EKY++DIV+D P L GRYQWVR+H Sbjct: 155 FFVMAEKYEQKRFVEKYNFDIVRDMP-LEGRYQWVRLH 191 >ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Vitis vinifera] Length = 203 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF+ AE+Y Q+RF EKY+YDIVKDAP + GRYQWVR+ Sbjct: 166 FFSAAEKYQQQRFAEKYNYDIVKDAP-MEGRYQWVRL 201 >emb|CBI32432.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF+ AE+Y Q+RF EKY+YDIVKDAP + GRYQWVR+ Sbjct: 197 FFSAAEKYQQQRFAEKYNYDIVKDAP-MEGRYQWVRL 232 >ref|XP_004136985.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Cucumis sativus] Length = 208 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF+EAE+Y QKRF+EKY++DI+ D P L GRYQW+R+ Sbjct: 171 FFSEAEKYEQKRFSEKYNFDIIMDVP-LEGRYQWIRL 206 >emb|CAC41621.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] Length = 195 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF+ AE Y QKRFTEKY+YDIV D P L GRYQWV + Sbjct: 158 FFSAAERYEQKRFTEKYNYDIVNDTP-LEGRYQWVSL 193 >ref|NP_175385.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] gi|152032531|sp|Q94CL9.2|KRP7_ARATH RecName: Full=Cyclin-dependent kinase inhibitor 7; AltName: Full=Inhibitor/interactor of CDK protein 5; AltName: Full=KIP-related protein 7 gi|10120423|gb|AAG13048.1|AC011807_7 Hypothetical protein [Arabidopsis thaliana] gi|332194329|gb|AEE32450.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] Length = 195 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF+ AE Y QKRFTEKY+YDIV D P L GRYQWV + Sbjct: 158 FFSAAERYEQKRFTEKYNYDIVNDTP-LEGRYQWVSL 193 >ref|XP_002518785.1| conserved hypothetical protein [Ricinus communis] gi|223542166|gb|EEF43710.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF EAE+ QKRF +KY+YDIVKD P L GRYQWVR+ Sbjct: 165 FFAEAEKKEQKRFADKYNYDIVKDLP-LEGRYQWVRL 200 >ref|XP_002523560.1| conserved hypothetical protein [Ricinus communis] gi|223537122|gb|EEF38755.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 353 FFTEAEEYVQKRFTEKYSYDIVKDAPILGGRYQWVRM 243 FF EAE +QKRF +KY+YD+VKD P L GRY+WVR+ Sbjct: 182 FFAEAERNIQKRFADKYNYDVVKDEP-LKGRYEWVRL 217