BLASTX nr result
ID: Mentha23_contig00045180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00045180 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40014.1| hypothetical protein MIMGU_mgv1a007872mg [Mimulus... 63 5e-08 >gb|EYU40014.1| hypothetical protein MIMGU_mgv1a007872mg [Mimulus guttatus] gi|604336184|gb|EYU40015.1| hypothetical protein MIMGU_mgv1a007872mg [Mimulus guttatus] Length = 392 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 333 DMKNEIFTFLESSDPSKAITTADIQQVFENLA 238 DMKNE+F+FLESSDPSKAITTAD+QQVFENLA Sbjct: 354 DMKNELFSFLESSDPSKAITTADVQQVFENLA 385