BLASTX nr result
ID: Mentha23_contig00044835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044835 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36697.1| hypothetical protein MIMGU_mgv1a007162mg [Mimulus... 60 2e-07 >gb|EYU36697.1| hypothetical protein MIMGU_mgv1a007162mg [Mimulus guttatus] gi|604331840|gb|EYU36698.1| hypothetical protein MIMGU_mgv1a007162mg [Mimulus guttatus] Length = 417 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 6/70 (8%) Frame = -3 Query: 196 MACYQIPHQHLHAFWRTSYCC--RRISVNQ----KLKSLGDSRRTYSSRVLFEKGSCKVL 35 MAC+ IP +H WR YCC + +SVN+ KL ++G+ RRTYSS L +K C+ Sbjct: 1 MACFHIPQ--IHGVWRGIYCCVGKNLSVNKRICHKLITVGNPRRTYSSSTLLKKDFCQGC 58 Query: 34 PGLSSGFCKV 5 L+SGFC+V Sbjct: 59 RSLNSGFCEV 68