BLASTX nr result
ID: Mentha23_contig00044742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044742 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Mimulus... 63 4e-08 >gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Mimulus guttatus] Length = 893 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/57 (59%), Positives = 40/57 (70%) Frame = -2 Query: 401 SLPLGFAEVSSLQVVELYCTNSSAAASARAIKQRKEEMAKKQSNVTVIFKLSVYPXE 231 SLPL F +V LQVV++YCTN S AASAR I+ RK E+ KQS FKLSVYP + Sbjct: 836 SLPLVFGDVVCLQVVDIYCTNESVAASARKIEGRKMELQGKQSGRGNGFKLSVYPPD 892