BLASTX nr result
ID: Mentha23_contig00044710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044710 (547 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37075.1| DnaJ homolog subfamily C member 13 [Morus notabilis] 56 5e-06 >gb|EXB37075.1| DnaJ homolog subfamily C member 13 [Morus notabilis] Length = 2650 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 3/53 (5%) Frame = -2 Query: 222 LGANQSRQ-RPLPSSSAG-GIWFFLRPR-PPRYHSLHYLPDPQMDFVSRHAAD 73 LGANQSR R PS AG G+W FLRP PR H+LHYLP + VSRH D Sbjct: 6 LGANQSRSHRAPPSGQAGVGLWLFLRPNNAPRAHTLHYLPHVESSLVSRHTVD 58