BLASTX nr result
ID: Mentha23_contig00044253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044253 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat... 63 5e-08 ref|XP_002314911.1| pentatricopeptide repeat-containing family p... 62 6e-08 ref|XP_007045718.1| Pentatricopeptide repeat-containing protein ... 60 4e-07 ref|XP_006348632.1| PREDICTED: putative pentatricopeptide repeat... 58 1e-06 ref|XP_003628710.1| Pentatricopeptide repeat-containing protein ... 58 1e-06 ref|XP_007226966.1| hypothetical protein PRUPE_ppa025241mg [Prun... 57 2e-06 ref|XP_004239007.1| PREDICTED: putative pentatricopeptide repeat... 57 2e-06 gb|EXB44921.1| hypothetical protein L484_026509 [Morus notabilis] 57 3e-06 ref|XP_006391071.1| hypothetical protein EUTSA_v10019713mg [Eutr... 56 6e-06 gb|EPS64639.1| hypothetical protein M569_10140, partial [Genlise... 55 8e-06 >ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930 [Vitis vinifera] gi|297738214|emb|CBI27415.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/61 (42%), Positives = 42/61 (68%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 ++N+L+T +Y N YA +VFD + + N+F WNTILS+Y K G ++ M ++F +P +D Sbjct: 42 LSNNLITAYYKLGNLAYAHHVFDHIPQPNLFSWNTILSVYSKLGLLSQMQQIFNLMPFRD 101 Query: 255 G 257 G Sbjct: 102 G 102 >ref|XP_002314911.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222863951|gb|EEF01082.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 743 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/59 (44%), Positives = 41/59 (69%) Frame = +3 Query: 81 NDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKDG 257 N+L+ + N TYA +VFD+M + N F WNT+LS Y K GD+++M ++F+ +P +DG Sbjct: 44 NNLINAYSKLGNITYARHVFDKMPQPNSFSWNTMLSAYSKSGDLSTMQEIFSIMPNRDG 102 >ref|XP_007045718.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] gi|508709653|gb|EOY01550.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] Length = 800 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/61 (40%), Positives = 41/61 (67%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N+LV + + TYA YVFD++ + N+F WNTIL Y K G+++ M+ +F +P++D Sbjct: 99 LLNNLVNAYSKLGDLTYARYVFDRILRPNLFSWNTILFTYSKAGNLSDMDYIFNRMPKRD 158 Query: 255 G 257 G Sbjct: 159 G 159 >ref|XP_006348632.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Solanum tuberosum] Length = 746 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/61 (39%), Positives = 41/61 (67%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N+L+ + NN+ YA VF+++ + N F WNTILS+Y K G+++ M +F +P++D Sbjct: 45 LLNNLINAYSKLNNTGYARQVFEEIPQPNQFSWNTILSVYSKSGNLSRMLDVFNRMPKRD 104 Query: 255 G 257 G Sbjct: 105 G 105 >ref|XP_003628710.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522732|gb|AET03186.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 748 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N+L++ + + YA VFDQM N++ WNTILS Y K G V+ M +F ++PR+D Sbjct: 46 LLNNLISSYAKLGSIPYACKVFDQMPHPNLYSWNTILSAYSKLGRVSEMEYLFDAMPRRD 105 Query: 255 G 257 G Sbjct: 106 G 106 >ref|XP_007226966.1| hypothetical protein PRUPE_ppa025241mg [Prunus persica] gi|462423902|gb|EMJ28165.1| hypothetical protein PRUPE_ppa025241mg [Prunus persica] Length = 743 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/61 (40%), Positives = 38/61 (62%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N+++T + N YA +VFDQM +F WN ILS+Y K G ++ M ++F +PR D Sbjct: 42 LLNNIITTYGRLGNLRYARHVFDQMPHPTLFSWNAILSVYSKSGYLSDMQEIFDRMPRLD 101 Query: 255 G 257 G Sbjct: 102 G 102 >ref|XP_004239007.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Solanum lycopersicum] Length = 743 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/61 (37%), Positives = 41/61 (67%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N+L+ + NN+ YA VF+++ + N F WNT+LS+Y K G+++ M +F +P++D Sbjct: 42 LLNNLINAYSKLNNTGYARQVFEEIPQPNQFSWNTVLSVYSKCGNISRMLDVFNRMPKRD 101 Query: 255 G 257 G Sbjct: 102 G 102 >gb|EXB44921.1| hypothetical protein L484_026509 [Morus notabilis] Length = 743 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/61 (39%), Positives = 39/61 (63%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 ++N L+ + YA ++FDQM ++N+F WNTILS Y K G ++ M ++F +P +D Sbjct: 42 LSNKLIDAYGKLGKVRYARHLFDQMPQRNLFSWNTILSAYSKSGYLSEMQEIFDRMPSRD 101 Query: 255 G 257 G Sbjct: 102 G 102 >ref|XP_006391071.1| hypothetical protein EUTSA_v10019713mg [Eutrema salsugineum] gi|557087505|gb|ESQ28357.1| hypothetical protein EUTSA_v10019713mg [Eutrema salsugineum] Length = 743 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N++V G+ NSTYA VFD++ K N F WN +L Y + G ++ M + F IP +D Sbjct: 43 LLNNIVHGYAKTRNSTYARRVFDEIPKPNPFSWNNLLMAYSQSGHLSEMERTFERIPIRD 102 Query: 255 G 257 G Sbjct: 103 G 103 >gb|EPS64639.1| hypothetical protein M569_10140, partial [Genlisea aurea] Length = 737 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/61 (37%), Positives = 38/61 (62%) Frame = +3 Query: 75 ITNDLVTGHYTWNNSTYASYVFDQMRKQNIFYWNTILSIYPKQGDVASMNKMFTSIPRKD 254 + N+ V+ + + YA +FDQ+ + N+F WN+I++ Y G A M ++F SIP+KD Sbjct: 35 LLNNFVSSYGKMESIEYARKMFDQIPRPNVFSWNSIMAAYSLNGHTAEMQELFNSIPKKD 94 Query: 255 G 257 G Sbjct: 95 G 95