BLASTX nr result
ID: Mentha23_contig00044197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044197 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468468.1| PREDICTED: probable LRR receptor-like serine... 60 4e-07 ref|XP_006448826.1| hypothetical protein CICLE_v10017495mg [Citr... 60 4e-07 ref|XP_002317693.2| hypothetical protein POPTR_0011s16090g [Popu... 59 7e-07 ref|XP_002269737.1| PREDICTED: probable LRR receptor-like serine... 58 2e-06 ref|XP_002533772.1| ATP binding protein, putative [Ricinus commu... 57 4e-06 gb|EYU19091.1| hypothetical protein MIMGU_mgv1a020030mg, partial... 56 6e-06 ref|XP_003524097.1| PREDICTED: probable LRR receptor-like serine... 56 6e-06 >ref|XP_006468468.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g23950-like [Citrus sinensis] Length = 533 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNSTN 2 VVEDLNNL PPDFNSTI NC NPSL+YCNS++ Sbjct: 27 VVEDLNNLHPPPDFNSTIMNNCIHNPSLKYCNSSS 61 >ref|XP_006448826.1| hypothetical protein CICLE_v10017495mg [Citrus clementina] gi|557551437|gb|ESR62066.1| hypothetical protein CICLE_v10017495mg [Citrus clementina] Length = 591 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNSTN 2 VVEDLNNL PPDFNSTI NC NPSL+YCNS++ Sbjct: 85 VVEDLNNLHPPPDFNSTIMNNCIHNPSLKYCNSSS 119 >ref|XP_002317693.2| hypothetical protein POPTR_0011s16090g [Populus trichocarpa] gi|550328509|gb|EEE98305.2| hypothetical protein POPTR_0011s16090g [Populus trichocarpa] Length = 531 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNSTN 2 VVEDL NLQ P DFN+TI KNC+ NPSLRYCNS++ Sbjct: 26 VVEDLANLQPPSDFNTTIMKNCQHNPSLRYCNSSS 60 >ref|XP_002269737.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g23950 [Vitis vinifera] gi|297740915|emb|CBI31097.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNSTN 2 VVEDLNNL P DFNSTI NC NPSLRYCNS++ Sbjct: 34 VVEDLNNLHPPSDFNSTINNNCLNNPSLRYCNSSS 68 >ref|XP_002533772.1| ATP binding protein, putative [Ricinus communis] gi|223526309|gb|EEF28617.1| ATP binding protein, putative [Ricinus communis] Length = 532 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNST 5 VVEDL NL+ PPDFNST+ KNC NPS RYCNS+ Sbjct: 27 VVEDLANLKPPPDFNSTLKKNCLHNPSHRYCNSS 60 >gb|EYU19091.1| hypothetical protein MIMGU_mgv1a020030mg, partial [Mimulus guttatus] Length = 560 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNST 5 VVEDLNNLQ P +FNSTI NC NPSLRYC +T Sbjct: 58 VVEDLNNLQPPANFNSTITNNCLTNPSLRYCGTT 91 >ref|XP_003524097.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20450-like [Glycine max] Length = 527 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 106 VVEDLNNLQLPPDFNSTIAKNCRQNPSLRYCNST 5 V+EDL NL PPDFNSTI NC +NPSLRYC+S+ Sbjct: 27 VLEDLKNLHQPPDFNSTIFSNCLKNPSLRYCSSS 60