BLASTX nr result
ID: Mentha23_contig00044121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044121 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27247.1| hypothetical protein MIMGU_mgv1a004049mg [Mimulus... 56 5e-06 >gb|EYU27247.1| hypothetical protein MIMGU_mgv1a004049mg [Mimulus guttatus] Length = 547 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 370 TAYELLSSPLTMASYGDVLHLPSYEQVSSRFH*K 269 TA +++SSPLTMASYGDVLHLPSY+ +S RFH K Sbjct: 514 TAQKIISSPLTMASYGDVLHLPSYDAISRRFHSK 547