BLASTX nr result
ID: Mentha23_contig00044028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00044028 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45036.1| hypothetical protein MIMGU_mgv1a000961mg [Mimulus... 55 6e-16 >gb|EYU45036.1| hypothetical protein MIMGU_mgv1a000961mg [Mimulus guttatus] Length = 931 Score = 55.1 bits (131), Expect(2) = 6e-16 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 98 RLCLNSWARGCAETP*FLRDEFVLLRNAFG 9 RLCLNSWARGCAE P FLRDE LLR+AFG Sbjct: 67 RLCLNSWARGCAEAPEFLRDECQLLRSAFG 96 Score = 54.3 bits (129), Expect(2) = 6e-16 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = -3 Query: 291 MNIGNACDYEAGSKKSIDNQYKGLEQGFSSDKGFVEQSNKSVKTETDVGQS-QNAYRALV 115 M+ GN E S+KSID Q K +Q FS+DK F EQ+ +S +TET + +S QN ++AL+ Sbjct: 1 MDTGNDRGSEVVSEKSIDGQLKEPKQSFSADKKFPEQNQESAETETGMHKSGQNGWQALI 60 Query: 114 ACDA 103 A DA Sbjct: 61 AYDA 64