BLASTX nr result
ID: Mentha23_contig00043949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043949 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25796.1| hypothetical protein MIMGU_mgv1a000111mg [Mimulus... 62 6e-08 >gb|EYU25796.1| hypothetical protein MIMGU_mgv1a000111mg [Mimulus guttatus] Length = 1756 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/80 (42%), Positives = 50/80 (62%) Frame = -3 Query: 310 IDRSISTIPGYSSPSTEKPQARQQPSNAFQSRNDPSLDSRWSPLDSMSEAESNLSKGSTA 131 IDRSIST+PGYS+PS +KP+A+Q AFQS ND ++ S+GS A Sbjct: 663 IDRSISTVPGYSAPSPDKPEAQQHLRQAFQSTND------------FEHSDPIPSEGSIA 710 Query: 130 QVPNAESKIRNLDAVTTGAD 71 PN+ES+++++D ++G D Sbjct: 711 --PNSESELKSVDVTSSGTD 728