BLASTX nr result
ID: Mentha23_contig00043897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043897 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22618.1| hypothetical protein MIMGU_mgv1a024305mg, partial... 95 1e-17 >gb|EYU22618.1| hypothetical protein MIMGU_mgv1a024305mg, partial [Mimulus guttatus] Length = 164 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/69 (63%), Positives = 52/69 (75%) Frame = -1 Query: 316 LSHNRFNFIFHGSPFSFRRRNPSHIALSASIAEKNSSLEFSWISSDKVSADDYNGWAIDE 137 L RFNF F G+P R RNPSH +SASIAEKNS LEFSW+SSDK S D+YNGW I E Sbjct: 19 LLRRRFNFSFSGNPLHIRPRNPSHFPISASIAEKNSGLEFSWVSSDKASDDEYNGWDIVE 78 Query: 136 ASPKLVEKK 110 ++P+ V+KK Sbjct: 79 SAPEPVQKK 87