BLASTX nr result
ID: Mentha23_contig00043846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043846 (643 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73380.1| hypothetical protein M569_01382 [Genlisea aurea] 89 1e-15 gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Mimulus... 56 8e-06 >gb|EPS73380.1| hypothetical protein M569_01382 [Genlisea aurea] Length = 165 Score = 88.6 bits (218), Expect = 1e-15 Identities = 43/87 (49%), Positives = 63/87 (72%) Frame = -2 Query: 627 MKQQLLFALKFLTLSGVYMFTRSRTPANKLKTPEKSLAVLFILENLKRIFIDNRRLIKDS 448 M+QQL A KF+ ++G+Y+FTRSRTP + + PE SL V+ +L NL+ +I N RLI + Sbjct: 1 MRQQLQLAFKFVAIAGIYLFTRSRTPPRERRNPEHSLLVIILLGNLRNSWIQNGRLIAGA 60 Query: 447 KTEVEILDNDVRLFKAFLKDCENRRTR 367 +T+ +L+ D+ LFKAFL+D + RRTR Sbjct: 61 ETDAYLLEKDIVLFKAFLED-DRRRTR 86 >gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Mimulus guttatus] Length = 893 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = -2 Query: 516 AVLFILENLKRIFIDNRRLIKDSKTEVEILDNDVRLFKAFLKDCENRRTRN 364 AV F+LENLK++ + N +LI D K +VE L ND+ LFKAFLKD +R+++ Sbjct: 5 AVEFLLENLKQLLLYNAKLITDIKDQVEFLYNDLTLFKAFLKDSTEKRSKH 55