BLASTX nr result
ID: Mentha23_contig00043812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043812 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Mimulus... 60 4e-07 >gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Mimulus guttatus] gi|604341113|gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Mimulus guttatus] Length = 987 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -2 Query: 326 MSAVDKILHEE--PANNTWLALRLPPSSPFDNFLRAARG 216 +S +DKI + E PA NTWLALRLPP+SPFDNFLRAARG Sbjct: 949 LSVIDKISNGENVPAANTWLALRLPPTSPFDNFLRAARG 987