BLASTX nr result
ID: Mentha23_contig00043782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043782 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 82 8e-14 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 82.0 bits (201), Expect = 8e-14 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = +2 Query: 185 RDVAQLGSAFVLGTKCHGFKSCHPYLLLPR*AVTRNQLRSFQIALRGIVHFYETIE 352 RDVAQLGSAFVLGTKCHGFKSCHPYLLL + AV++N++RS +IA +FYETIE Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRSIEIA--RTPYFYETIE 54