BLASTX nr result
ID: Mentha23_contig00043487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043487 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36870.1| hypothetical protein MIMGU_mgv1a001096mg [Mimulus... 65 1e-08 >gb|EYU36870.1| hypothetical protein MIMGU_mgv1a001096mg [Mimulus guttatus] Length = 890 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/41 (80%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +2 Query: 224 MDDLDVLARDFGLAGRGKSNPMRS-TAPDRRSMDDPLFSDV 343 MDDLD+L RD GL RGKSNPMRS A DRRSMDDPLFSDV Sbjct: 1 MDDLDMLGRDIGLGTRGKSNPMRSGPAADRRSMDDPLFSDV 41