BLASTX nr result
ID: Mentha23_contig00043474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043474 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial... 100 3e-19 gb|EPS58257.1| hypothetical protein M569_16559 [Genlisea aurea] 74 2e-11 gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis] 72 6e-11 ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 emb|CBI30210.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_004231252.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Popu... 65 1e-08 ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002528626.1| pentatricopeptide repeat-containing protein,... 64 3e-08 ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prun... 62 6e-08 emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera] 62 8e-08 ref|XP_004305376.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citr... 61 1e-07 ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_002873115.1| EMB175 [Arabidopsis lyrata subsp. lyrata] gi... 60 4e-07 ref|NP_196000.2| pentatricopeptide repeat protein EMB175 [Arabid... 59 5e-07 emb|CAB85500.1| putative protein [Arabidopsis thaliana] 59 5e-07 ref|XP_006402229.1| hypothetical protein EUTSA_v10015790mg [Eutr... 59 7e-07 >gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial [Mimulus guttatus] Length = 722 Score = 100 bits (248), Expect = 3e-19 Identities = 50/66 (75%), Positives = 58/66 (87%) Frame = -2 Query: 200 ITRLLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKP 21 ++RLLKLS +YADIQLGKA+HAS++K QDVRL NSLI+SY ELG LNYA RVF+SIL P Sbjct: 1 LSRLLKLSIEYADIQLGKAVHASVLKFEQDVRLFNSLITSYFELGKLNYAERVFDSILAP 60 Query: 20 DVVSYT 3 DVVSYT Sbjct: 61 DVVSYT 66 >gb|EPS58257.1| hypothetical protein M569_16559 [Genlisea aurea] Length = 846 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/74 (51%), Positives = 56/74 (75%), Gaps = 1/74 (1%) Frame = -2 Query: 221 QPLSNDEITRLLKLSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGR 45 +P SN +++RLLKLS +Y D+ KA+HASI++ +D +RL NSL+++Y+ LG +N A Sbjct: 33 RPPSNGDLSRLLKLSIEYGDVNFCKAVHASILRGEEDDIRLQNSLVTAYLRLGRVNDAES 92 Query: 44 VFNSILKPDVVSYT 3 VF+SI PDVVS+T Sbjct: 93 VFDSIPCPDVVSHT 106 >gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis] Length = 911 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/75 (48%), Positives = 53/75 (70%) Frame = -2 Query: 227 NFQPLSNDEITRLLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAG 48 NF D + LL+LS Y D++L KA+HAS++K+ +DV L NSLIS+Y++LG ++ A Sbjct: 94 NFVEFDVDGLLHLLQLSVRYNDVELAKAVHASVVKLGEDVYLGNSLISAYLKLGFVSEAY 153 Query: 47 RVFNSILKPDVVSYT 3 VF ++ PD+VSYT Sbjct: 154 EVFMAMASPDLVSYT 168 >ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Vitis vinifera] Length = 882 Score = 72.0 bits (175), Expect = 8e-11 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 3/101 (2%) Frame = -2 Query: 296 SAPSFLLTKTPPFEHISTPKHPENFQPLSNDEITR---LLKLSRDYADIQLGKALHASII 126 S P LLT PP + P NF +SND + LL LS Y D++L KA+HASI Sbjct: 42 SKPYALLTSHPPLSN--QPALLSNFPSVSNDTVNDHYYLLDLSVRYDDVELIKAVHASIF 99 Query: 125 KVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVVSYT 3 K+ +D+ L N+LI +Y++LG + A +VF + P+VVSYT Sbjct: 100 KLAEDIHLANALIVAYLKLGMVPNAYKVFVGLSCPNVVSYT 140 >emb|CBI30210.3| unnamed protein product [Vitis vinifera] Length = 900 Score = 72.0 bits (175), Expect = 8e-11 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 3/101 (2%) Frame = -2 Query: 296 SAPSFLLTKTPPFEHISTPKHPENFQPLSNDEITR---LLKLSRDYADIQLGKALHASII 126 S P LLT PP + P NF +SND + LL LS Y D++L KA+HASI Sbjct: 60 SKPYALLTSHPPLSN--QPALLSNFPSVSNDTVNDHYYLLDLSVRYDDVELIKAVHASIF 117 Query: 125 KVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVVSYT 3 K+ +D+ L N+LI +Y++LG + A +VF + P+VVSYT Sbjct: 118 KLAEDIHLANALIVAYLKLGMVPNAYKVFVGLSCPNVVSYT 158 >ref|XP_004231252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Solanum lycopersicum] Length = 891 Score = 65.1 bits (157), Expect = 1e-08 Identities = 39/102 (38%), Positives = 60/102 (58%), Gaps = 9/102 (8%) Frame = -2 Query: 281 LLTKTPPFEHISTPKHPENFQPLSND--------EITRLLKLSRDYADIQLGKALHASII 126 L + P H+ P P+ F+ + + LL++S D++L K +H+S++ Sbjct: 48 LFLQNPSKSHLVQP--PQQFKDSNGSVDSETNCIDYANLLRISVRCGDVELTKIIHSSLV 105 Query: 125 KVRQ-DVRLCNSLISSYIELGHLNYAGRVFNSILKPDVVSYT 3 K + DV L N+LI++YI+LG LN A RVF+S+ PDVVSYT Sbjct: 106 KFEEEDVYLKNALIAAYIKLGCLNLAERVFDSLRSPDVVSYT 147 >ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] gi|550321242|gb|EEF05250.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] Length = 915 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/68 (48%), Positives = 48/68 (70%) Frame = -2 Query: 206 DEITRLLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSIL 27 D++ LL+LS Y DI L +ALHASI+K+ +D L N++I++YI+LG + A VF + Sbjct: 105 DDLFNLLRLSVKYTDIDLARALHASILKLGEDTHLGNAVIAAYIKLGLVVDAYEVFMGMS 164 Query: 26 KPDVVSYT 3 PDVVSY+ Sbjct: 165 TPDVVSYS 172 >ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Solanum tuberosum] Length = 894 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/68 (48%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Frame = -2 Query: 203 EITRLLKLSRDYADIQLGKALHASIIKVRQ-DVRLCNSLISSYIELGHLNYAGRVFNSIL 27 + LL++S D+ L K +H+S++K + DV L N+LI++YI+LG LN A RVF+S++ Sbjct: 83 DYANLLRISVRCGDVVLTKIIHSSLVKFEEEDVYLKNALIAAYIKLGCLNLAERVFDSLM 142 Query: 26 KPDVVSYT 3 PDVVSYT Sbjct: 143 SPDVVSYT 150 >ref|XP_002528626.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531915|gb|EEF33729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 537 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/76 (40%), Positives = 48/76 (63%) Frame = -2 Query: 230 ENFQPLSNDEITRLLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYA 51 + F + D + LL++S Y D L +ALHASI+K+ +D L N+L+ +Y++LG + A Sbjct: 78 DTFIDIGIDHLLNLLRISVRYTDFDLARALHASILKLGEDTHLGNALVVAYLKLGLVLDA 137 Query: 50 GRVFNSILKPDVVSYT 3 VF + PDVVSY+ Sbjct: 138 YEVFKGLCNPDVVSYS 153 >ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] gi|462398659|gb|EMJ04327.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] Length = 905 Score = 62.4 bits (150), Expect = 6e-08 Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 10/106 (9%) Frame = -2 Query: 290 PSFLL--TKTPPFEHISTPKHPENFQPLSNDEITR--------LLKLSRDYADIQLGKAL 141 P LL T PP + + T K P + + T LL+LS + D +L +A+ Sbjct: 57 PQLLLNFTALPPSQSLPTQKPLLPLTPPNGSDQTHFLFHHLLNLLRLSARHGDHELARAV 116 Query: 140 HASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVVSYT 3 HASI+K +D L N+LIS+Y++LG + A RVF S+ P+VVS+T Sbjct: 117 HASILKFEEDNHLGNALISAYLKLGLVPDAYRVFQSLSCPNVVSFT 162 >emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera] Length = 755 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 3/73 (4%) Frame = -2 Query: 212 SNDEITR---LLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRV 42 SND + LL LS Y D++L KA+HASI K+ +D+ L N+LI +Y++LG + A +V Sbjct: 70 SNDTVNDHYYLLDLSVRYDDVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVXNAXKV 129 Query: 41 FNSILKPDVVSYT 3 F + P+VVSYT Sbjct: 130 FVGLSCPNVVSYT 142 >ref|XP_004305376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like, partial [Fragaria vesca subsp. vesca] Length = 807 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/63 (47%), Positives = 45/63 (71%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 12 LL+LS +AD L +A+HAS +K+ D L N+L+S+Y++LG + A RVF S+ P+VV Sbjct: 1 LLRLSARHADADLARAVHASALKLESDTHLGNALVSAYLKLGLVPQAYRVFQSLPSPNVV 60 Query: 11 SYT 3 S+T Sbjct: 61 SFT 63 >ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Citrus sinensis] Length = 893 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/90 (36%), Positives = 52/90 (57%), Gaps = 2/90 (2%) Frame = -2 Query: 266 PPFEHISTPKHPENFQPLSNDEITRLLKLSRDYADIQLGKALHASIIKV--RQDVRLCNS 93 PP + +P + D L+LS ++ L KA+HAS+IK+ QD R N Sbjct: 60 PPDPLVVSPSSNTKVIDVDVDSFFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNP 119 Query: 92 LISSYIELGHLNYAGRVFNSILKPDVVSYT 3 LIS+Y++LGH++ A ++F + P+VVS+T Sbjct: 120 LISAYLKLGHVSDAYKIFYGLSSPNVVSFT 149 >ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citrus clementina] gi|557532404|gb|ESR43587.1| hypothetical protein CICLE_v10011036mg [Citrus clementina] Length = 893 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/90 (36%), Positives = 52/90 (57%), Gaps = 2/90 (2%) Frame = -2 Query: 266 PPFEHISTPKHPENFQPLSNDEITRLLKLSRDYADIQLGKALHASIIKV--RQDVRLCNS 93 PP + +P + D L+LS ++ L KA+HAS+IK+ QD R N Sbjct: 60 PPDPLVVSPSSNTKVIDVDVDSFFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNP 119 Query: 92 LISSYIELGHLNYAGRVFNSILKPDVVSYT 3 LIS+Y++LGH++ A ++F + P+VVS+T Sbjct: 120 LISAYLKLGHVSDAYKIFYGLSSPNVVSFT 149 >ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/63 (46%), Positives = 45/63 (71%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 12 LL+LS Y D L +A+HA +K+ +D+ L N+LIS+Y++LG + A +VF+ + P+VV Sbjct: 103 LLRLSTRYGDPDLARAVHAQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLSCPNVV 162 Query: 11 SYT 3 SYT Sbjct: 163 SYT 165 >ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/63 (46%), Positives = 45/63 (71%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 12 LL+LS Y D L +A+HA +K+ +D+ L N+LIS+Y++LG + A +VF+ + P+VV Sbjct: 103 LLRLSTRYGDPDLARAVHAQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLSCPNVV 162 Query: 11 SYT 3 SYT Sbjct: 163 SYT 165 >ref|XP_002873115.1| EMB175 [Arabidopsis lyrata subsp. lyrata] gi|297318952|gb|EFH49374.1| EMB175 [Arabidopsis lyrata subsp. lyrata] Length = 896 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 15 LL+LS Y D+++ KA+HAS +K+R++ RL N+LIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREEKTRLGNALISTYLKLGFPREAFLVFVSLSSPTV 145 Query: 14 VSYT 3 VSYT Sbjct: 146 VSYT 149 >ref|NP_196000.2| pentatricopeptide repeat protein EMB175 [Arabidopsis thaliana] gi|75170265|sp|Q9FFN1.1|PP363_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g03800; AltName: Full=Protein EMBRYO DEFECTIVE 175 gi|9758009|dbj|BAB08606.1| selenium-binding protein-like [Arabidopsis thaliana] gi|26449508|dbj|BAC41880.1| unknown protein [Arabidopsis thaliana] gi|58013014|gb|AAW62960.1| embryo-defective 175 [Arabidopsis thaliana] gi|58013016|gb|AAW62961.1| embryo-defective 175 [Arabidopsis thaliana] gi|332003273|gb|AED90656.1| pentatricopeptide repeat protein EMB175 [Arabidopsis thaliana] gi|591401840|gb|AHL38647.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 896 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 15 LL+LS Y D+++ KA+HAS +K+R++ RL N+LIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREEKTRLGNALISTYLKLGFPREAILVFVSLSSPTV 145 Query: 14 VSYT 3 VSYT Sbjct: 146 VSYT 149 >emb|CAB85500.1| putative protein [Arabidopsis thaliana] Length = 837 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 15 LL+LS Y D+++ KA+HAS +K+R++ RL N+LIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREEKTRLGNALISTYLKLGFPREAILVFVSLSSPTV 145 Query: 14 VSYT 3 VSYT Sbjct: 146 VSYT 149 >ref|XP_006402229.1| hypothetical protein EUTSA_v10015790mg [Eutrema salsugineum] gi|557103319|gb|ESQ43682.1| hypothetical protein EUTSA_v10015790mg [Eutrema salsugineum] Length = 831 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -2 Query: 191 LLKLSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 15 LL+LS Y D+++ KA+HAS +K+R++ + L NSLIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREETIDLGNSLISAYLKLGFPRDAFLVFVSLSSPTV 145 Query: 14 VSYT 3 VSYT Sbjct: 146 VSYT 149