BLASTX nr result
ID: Mentha23_contig00043388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043388 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44038.1| hypothetical protein MIMGU_mgv1a001643mg [Mimulus... 116 3e-24 ref|XP_006472234.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 ref|XP_006433563.1| hypothetical protein CICLE_v10000386mg [Citr... 108 8e-22 ref|XP_007207552.1| hypothetical protein PRUPE_ppa017672mg [Prun... 108 1e-21 ref|XP_006344853.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_006382364.1| hypothetical protein POPTR_0005s01450g, part... 106 3e-21 ref|XP_004500093.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 ref|XP_004304908.1| PREDICTED: pentatricopeptide repeat-containi... 105 6e-21 ref|XP_006602194.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 ref|XP_007137380.1| hypothetical protein PHAVU_009G122500g [Phas... 102 4e-20 gb|EXC31178.1| hypothetical protein L484_004944 [Morus notabilis] 101 1e-19 ref|XP_007147940.1| hypothetical protein PHAVU_006G167300g [Phas... 100 2e-19 ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CBI39619.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_002277347.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CAN67095.1| hypothetical protein VITISV_016806 [Vitis vinifera] 100 2e-19 ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily p... 99 5e-19 ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 >gb|EYU44038.1| hypothetical protein MIMGU_mgv1a001643mg [Mimulus guttatus] Length = 780 Score = 116 bits (291), Expect = 3e-24 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 ATS PAPIRIIKNLRIC DCH AAKLVS AFDREIV+RDRHRFHHFKHGSCSC DYW Sbjct: 724 ATSGPAPIRIIKNLRICGDCHAAAKLVSEAFDREIVIRDRHRFHHFKHGSCSCMDYW 780 >ref|XP_006472234.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Citrus sinensis] Length = 798 Score = 108 bits (270), Expect = 8e-22 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -2 Query: 440 SAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 S P PIRI+KNLRIC+DCH AAK +SRAFDREIVVRDRHRFHHFKHGSCSC D+W Sbjct: 744 SPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW 798 >ref|XP_006433563.1| hypothetical protein CICLE_v10000386mg [Citrus clementina] gi|557535685|gb|ESR46803.1| hypothetical protein CICLE_v10000386mg [Citrus clementina] Length = 746 Score = 108 bits (270), Expect = 8e-22 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -2 Query: 440 SAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 S P PIRI+KNLRIC+DCH AAK +SRAFDREIVVRDRHRFHHFKHGSCSC D+W Sbjct: 692 SPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW 746 >ref|XP_007207552.1| hypothetical protein PRUPE_ppa017672mg [Prunus persica] gi|462403194|gb|EMJ08751.1| hypothetical protein PRUPE_ppa017672mg [Prunus persica] Length = 745 Score = 108 bits (269), Expect = 1e-21 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = -2 Query: 443 TSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 TS P PIRIIKNLRIC+DCH+AAK +S+AF+R+IV+RDRHRFHHFK GSCSCKDYW Sbjct: 690 TSPPTPIRIIKNLRICNDCHMAAKFISKAFNRDIVLRDRHRFHHFKQGSCSCKDYW 745 >ref|XP_006344853.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 745 Score = 107 bits (266), Expect = 2e-21 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 A + P PIRIIKNLRICSDCH AAKL+S+AFDREIVVRDRHRFHHFK GSCSC ++W Sbjct: 689 AIAPPTPIRIIKNLRICSDCHAAAKLISKAFDREIVVRDRHRFHHFKDGSCSCMEFW 745 >ref|XP_006382364.1| hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] gi|550337723|gb|ERP60161.1| hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] Length = 788 Score = 106 bits (265), Expect = 3e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 A P PIRI+KNLRIC+DCH AAKL+S+AF+REIVVRDRHRFHHFK GSCSC DYW Sbjct: 732 AIDPPTPIRIVKNLRICNDCHTAAKLISKAFNREIVVRDRHRFHHFKQGSCSCMDYW 788 >ref|XP_004500093.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X1 [Cicer arietinum] gi|502128825|ref|XP_004500094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X2 [Cicer arietinum] Length = 785 Score = 106 bits (265), Expect = 3e-21 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -2 Query: 434 PAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 PAPIRI+KNLRIC+DCH KL+S+AFDREIV+RDRHRFHHFKHGSCSC D+W Sbjct: 733 PAPIRIMKNLRICNDCHTVVKLISKAFDREIVIRDRHRFHHFKHGSCSCMDFW 785 >ref|XP_004304908.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 777 Score = 105 bits (262), Expect = 6e-21 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 A S P+PIRIIKNLRIC+DCH+AAK VS+AF R+IVVRD+HRFHHFK GSCSC DYW Sbjct: 721 AISPPSPIRIIKNLRICNDCHMAAKFVSKAFGRDIVVRDKHRFHHFKQGSCSCNDYW 777 >ref|XP_006602194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform X1 [Glycine max] Length = 775 Score = 103 bits (256), Expect = 3e-20 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -2 Query: 440 SAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 S P PIR+ KNLRIC+DCH KL+S+AFDR+IVVRDRHRFHHFKHG+CSC D+W Sbjct: 721 SPPTPIRVTKNLRICNDCHTVVKLISKAFDRDIVVRDRHRFHHFKHGACSCMDFW 775 >ref|XP_007137380.1| hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] gi|561010467|gb|ESW09374.1| hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] Length = 774 Score = 102 bits (255), Expect = 4e-20 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -2 Query: 434 PAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 P PIR++KNLRIC+DCH KL+S+AFDREIVVRDRHRFHHF+HG+CSC D+W Sbjct: 722 PTPIRVMKNLRICNDCHTVVKLISKAFDREIVVRDRHRFHHFRHGACSCMDFW 774 >gb|EXC31178.1| hypothetical protein L484_004944 [Morus notabilis] Length = 745 Score = 101 bits (251), Expect = 1e-19 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 +TS P PIRI+KNLRIC+DCH AAK +S+A+DR IVVRDRHRFHHF GSCSC DYW Sbjct: 689 STSPPTPIRIMKNLRICNDCHNAAKFISKAYDRVIVVRDRHRFHHFDQGSCSCLDYW 745 >ref|XP_007147940.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris] gi|561021163|gb|ESW19934.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris] Length = 611 Score = 100 bits (249), Expect = 2e-19 Identities = 40/56 (71%), Positives = 50/56 (89%) Frame = -2 Query: 443 TSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 T+ APIR++KNLR+C+DCHVA KL+S+ +DREIV+RDR RFHHF+ GSCSCKDYW Sbjct: 556 TAPAAPIRVVKNLRVCADCHVAIKLISKIYDREIVIRDRSRFHHFRGGSCSCKDYW 611 >ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 613 Score = 100 bits (249), Expect = 2e-19 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -2 Query: 443 TSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 T+A PIR++KNLR+C+DCH+A KL+S+ FDREIVVRDR RFHHFK G CSCKDYW Sbjct: 558 TAAGIPIRVVKNLRVCADCHLAIKLISKVFDREIVVRDRSRFHHFKDGHCSCKDYW 613 >emb|CBI39619.3| unnamed protein product [Vitis vinifera] Length = 640 Score = 100 bits (249), Expect = 2e-19 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -2 Query: 440 SAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 S P PIRI+KNLRIC+DCH AAKL+S+A+ REIVVRDRHRFH+FK G+CSC DYW Sbjct: 586 SPPTPIRIMKNLRICNDCHTAAKLISKAYAREIVVRDRHRFHYFKEGACSCMDYW 640 >ref|XP_002277347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 808 Score = 100 bits (249), Expect = 2e-19 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -2 Query: 440 SAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 S P PIRI+KNLRIC+DCH AAKL+S+A+ REIVVRDRHRFH+FK G+CSC DYW Sbjct: 754 SPPTPIRIMKNLRICNDCHTAAKLISKAYAREIVVRDRHRFHYFKEGACSCMDYW 808 >emb|CAN67095.1| hypothetical protein VITISV_016806 [Vitis vinifera] Length = 348 Score = 100 bits (249), Expect = 2e-19 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -2 Query: 443 TSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 T+A PIR++KNLR+C+DCH+A KL+S+ FDREIVVRDR RFHHFK G CSCKDYW Sbjct: 293 TAAGIPIRVVKNLRVCADCHLAIKLISKVFDREIVVRDRSRFHHFKDGHCSCKDYW 348 >ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum tuberosum] Length = 585 Score = 99.4 bits (246), Expect = 5e-19 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 +T PIRI+KNLR+C+DCH+A KL+S+ FDREIVVRDR RFHHF +GSCSCKDYW Sbjct: 529 STPPGTPIRIVKNLRVCADCHLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508717783|gb|EOY09680.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 626 Score = 99.4 bits (246), Expect = 5e-19 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -2 Query: 443 TSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 T A PIRI+KNLR+C DCH A KL+S+ F+RE++VRDR+RFHHF+HG+CSC DYW Sbjct: 571 TKASMPIRIVKNLRVCEDCHTATKLISKVFERELIVRDRNRFHHFRHGTCSCMDYW 626 >ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Solanum lycopersicum] Length = 602 Score = 98.2 bits (243), Expect = 1e-18 Identities = 40/57 (70%), Positives = 50/57 (87%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 A+ + APIRIIKNLR+C+DCH A KL+SR ++REI+VRDR RFHHFK+G+CSC DYW Sbjct: 546 ASDSGAPIRIIKNLRVCNDCHTATKLISRIYEREIIVRDRSRFHHFKNGTCSCLDYW 602 >ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum lycopersicum] Length = 585 Score = 97.8 bits (242), Expect = 1e-18 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = -2 Query: 446 ATSAPAPIRIIKNLRICSDCHVAAKLVSRAFDREIVVRDRHRFHHFKHGSCSCKDYW 276 +T PIRI+KNLR+C+DCH+A KL+S+ F+REIVVRDR RFHHF +GSCSCKDYW Sbjct: 529 STPPGTPIRIVKNLRVCADCHLAIKLISKVFEREIVVRDRSRFHHFTNGSCSCKDYW 585