BLASTX nr result
ID: Mentha23_contig00043311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00043311 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29685.1| hypothetical protein MIMGU_mgv1a013352mg [Mimulus... 55 8e-06 >gb|EYU29685.1| hypothetical protein MIMGU_mgv1a013352mg [Mimulus guttatus] Length = 223 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 127 IHHNAQIQPQNLESNSPIQWKSDAQQQIYSSKLLRALQQVR 5 I H Q Q + E N IQWKSDAQQQIYSSKLL AL+QVR Sbjct: 28 IQHQTQNQSEITEINPTIQWKSDAQQQIYSSKLLHALKQVR 68