BLASTX nr result
ID: Mentha23_contig00042552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00042552 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298914.1| PREDICTED: uncharacterized protein LOC101293... 64 2e-08 ref|XP_002297971.1| phosphatidylinositol 3- and 4-kinase family ... 59 7e-07 ref|XP_004503611.1| PREDICTED: uncharacterized protein LOC101495... 58 1e-06 ref|XP_006439325.1| hypothetical protein CICLE_v10019472mg [Citr... 58 2e-06 ref|XP_003516722.1| PREDICTED: phosphatidylinositol 4-kinase gam... 58 2e-06 ref|XP_007210568.1| hypothetical protein PRUPE_ppa003867mg [Prun... 57 2e-06 ref|XP_007158588.1| hypothetical protein PHAVU_002G165100g [Phas... 57 3e-06 emb|CBI34497.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002268042.1| PREDICTED: uncharacterized protein LOC100249... 57 3e-06 emb|CAN83998.1| hypothetical protein VITISV_001390 [Vitis vinifera] 57 3e-06 gb|EYU40010.1| hypothetical protein MIMGU_mgv1a003591mg [Mimulus... 56 6e-06 ref|XP_006476369.1| PREDICTED: phosphatidylinositol 4-kinase gam... 55 8e-06 ref|XP_007040554.1| Phosphoinositide 4-kinase gamma 4, gamma 4,u... 55 8e-06 ref|XP_007051544.1| Phosphoinositide 4-kinase gamma 4, gamma 4,u... 55 8e-06 >ref|XP_004298914.1| PREDICTED: uncharacterized protein LOC101293093 [Fragaria vesca subsp. vesca] Length = 582 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE +NKKS+IEEIV ED++LPGMSEA FLE +SEIMDSRLDK Sbjct: 536 RENINKKSVIEEIVTEAEDSLLPGMSEATFLEAISEIMDSRLDK 579 >ref|XP_002297971.1| phosphatidylinositol 3- and 4-kinase family protein [Populus trichocarpa] gi|222845229|gb|EEE82776.1| phosphatidylinositol 3- and 4-kinase family protein [Populus trichocarpa] Length = 583 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE LNK+S+IEEI+ ED++LPGMSEAAFLE VS IMD RLD+ Sbjct: 537 RENLNKESVIEEIIREAEDSLLPGMSEAAFLEAVSNIMDYRLDE 580 >ref|XP_004503611.1| PREDICTED: uncharacterized protein LOC101495023 [Cicer arietinum] Length = 574 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/44 (63%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE LNK+S+IEEI+ +D++LPGM E+ FL++VS+IMDSRLDK Sbjct: 528 RENLNKESVIEEIISEAQDSLLPGMEESTFLDSVSQIMDSRLDK 571 >ref|XP_006439325.1| hypothetical protein CICLE_v10019472mg [Citrus clementina] gi|557541587|gb|ESR52565.1| hypothetical protein CICLE_v10019472mg [Citrus clementina] Length = 577 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE +NK+S+IEEIV +D++LPG+SEAAFLE VS+IMD RLDK Sbjct: 531 RETVNKESVIEEIVREAQDSLLPGISEAAFLETVSKIMDYRLDK 574 >ref|XP_003516722.1| PREDICTED: phosphatidylinositol 4-kinase gamma 4-like [Glycine max] Length = 569 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/44 (63%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE LNK+S+IEEI+ ++++LPGM E+ FLE+VS+IMDSRLDK Sbjct: 523 RENLNKESVIEEIICEAQESLLPGMEESVFLESVSQIMDSRLDK 566 >ref|XP_007210568.1| hypothetical protein PRUPE_ppa003867mg [Prunus persica] gi|462406303|gb|EMJ11767.1| hypothetical protein PRUPE_ppa003867mg [Prunus persica] Length = 543 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/44 (65%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE +NK+S+IEEIV +D++LPGMSEAAFLE +SE MD +LDK Sbjct: 497 RENINKESVIEEIVREAQDSLLPGMSEAAFLEAISEFMDLQLDK 540 >ref|XP_007158588.1| hypothetical protein PHAVU_002G165100g [Phaseolus vulgaris] gi|561032003|gb|ESW30582.1| hypothetical protein PHAVU_002G165100g [Phaseolus vulgaris] Length = 565 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE LNKKS+IEEI+ ++++LPGM E+ FLE+VS+I+DSR+DK Sbjct: 519 REDLNKKSVIEEIICEAQESLLPGMGESVFLESVSQIIDSRIDK 562 >emb|CBI34497.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/44 (63%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIVE---DAMLPGMSEAAFLENVSEIMDSRLDK 124 R LNK+S+IEEIV+ D++LPGMSEAAFLE +S+++D+RLDK Sbjct: 470 RVTLNKESVIEEIVQEAQDSLLPGMSEAAFLETISQLIDTRLDK 513 >ref|XP_002268042.1| PREDICTED: uncharacterized protein LOC100249570 [Vitis vinifera] Length = 583 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/44 (63%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIVE---DAMLPGMSEAAFLENVSEIMDSRLDK 124 R LNK+S+IEEIV+ D++LPGMSEAAFLE +S+++D+RLDK Sbjct: 537 RVTLNKESVIEEIVQEAQDSLLPGMSEAAFLETISQLIDTRLDK 580 >emb|CAN83998.1| hypothetical protein VITISV_001390 [Vitis vinifera] Length = 161 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/44 (63%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIVE---DAMLPGMSEAAFLENVSEIMDSRLDK 124 R LNK+S+IEEIV+ D++LPGMSEAAFLE +S+++D+RLDK Sbjct: 115 RVTLNKESVIEEIVQEAQDSLLPGMSEAAFLETISQLIDTRLDK 158 >gb|EYU40010.1| hypothetical protein MIMGU_mgv1a003591mg [Mimulus guttatus] Length = 575 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 4/45 (8%) Frame = +2 Query: 2 REKLNKKSMIEEIVEDA----MLPGMSEAAFLENVSEIMDSRLDK 124 RE LNKKS+IEEIV++A ++ GM+EAAFLE VSEIMD LDK Sbjct: 528 RETLNKKSVIEEIVDEAKEYSVISGMTEAAFLETVSEIMDETLDK 572 >ref|XP_006476369.1| PREDICTED: phosphatidylinositol 4-kinase gamma 4-like [Citrus sinensis] Length = 577 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/44 (65%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 RE +NK+S+IEEIV +D++LPG+SEAAFLE VS+I D RLDK Sbjct: 531 RETVNKESVIEEIVREAQDSLLPGISEAAFLETVSKITDYRLDK 574 >ref|XP_007040554.1| Phosphoinositide 4-kinase gamma 4, gamma 4,ubdk gamma 4,pi4k gamma 4 [Theobroma cacao] gi|508777799|gb|EOY25055.1| Phosphoinositide 4-kinase gamma 4, gamma 4,ubdk gamma 4,pi4k gamma 4 [Theobroma cacao] Length = 589 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIV---EDAMLPGMSEAAFLENVSEIMDSRLDK 124 R+ +NK+S+IE+IV +D++LPGMSEAAF+E VS++MDS LDK Sbjct: 543 RQTVNKESVIEQIVREAQDSLLPGMSEAAFIETVSQVMDSWLDK 586 >ref|XP_007051544.1| Phosphoinositide 4-kinase gamma 4, gamma 4,ubdk gamma 4,pi4k gamma 4 [Theobroma cacao] gi|508703805|gb|EOX95701.1| Phosphoinositide 4-kinase gamma 4, gamma 4,ubdk gamma 4,pi4k gamma 4 [Theobroma cacao] Length = 595 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/44 (63%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = +2 Query: 2 REKLNKKSMIEEIVE---DAMLPGMSEAAFLENVSEIMDSRLDK 124 RE LN++S+IEEIV+ D++LPG+SEAAFLE +S+IMD RLD+ Sbjct: 547 RENLNEESVIEEIVQEAQDSVLPGISEAAFLETLSQIMDRRLDE 590