BLASTX nr result
ID: Mentha23_contig00042401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00042401 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46090.1| hypothetical protein MIMGU_mgv1a012237mg [Mimulus... 57 4e-08 >gb|EYU46090.1| hypothetical protein MIMGU_mgv1a012237mg [Mimulus guttatus] Length = 257 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +1 Query: 64 MHLNSDQVSREV*FPICK*GKLQENGHDIYCSQVSMSLN 180 M LNSDQV+ EV PICK GKLQEN H IYCSQ + LN Sbjct: 162 MQLNSDQVAEEVWCPICKQGKLQENSHHIYCSQCKVKLN 200 Score = 26.2 bits (56), Expect(2) = 4e-08 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +3 Query: 21 DDEEIEYVPRIVYDH 65 +DEE EY+ R+V+DH Sbjct: 147 EDEEDEYLARVVFDH 161