BLASTX nr result
ID: Mentha23_contig00042261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00042261 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 57 3e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/93 (38%), Positives = 51/93 (54%), Gaps = 2/93 (2%) Frame = -3 Query: 283 VLSFDLGGETFDYFPVPPTAVSNAAY--ELLEYRGALGVIVYGLEVPRASFTEIWEWDHD 110 +LSFD+ E F P+P S A Y +LL++ G+LG IVY E S I W + Sbjct: 239 ILSFDMANEKFSTLPLPTFGGSLAQYYLQLLDFNGSLGAIVYPREGTEKS---IDLWVMN 295 Query: 109 QSCWNIFHTISLSHVDRPIGLWEDEFLFLEAKS 11 S F S+S V+RP+G W++ LFLE+ + Sbjct: 296 GSWTRQFSIESVSGVERPLGFWKNGELFLESSN 328