BLASTX nr result
ID: Mentha23_contig00042212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00042212 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342480.1| PREDICTED: alkylated DNA repair protein alkB... 59 7e-07 ref|XP_004253074.1| PREDICTED: alkylated DNA repair protein alkB... 59 7e-07 gb|EYU37445.1| hypothetical protein MIMGU_mgv1a009341mg [Mimulus... 58 2e-06 ref|XP_006494108.1| PREDICTED: alkylated DNA repair protein alkB... 57 2e-06 ref|XP_006432892.1| hypothetical protein CICLE_v10004016mg [Citr... 57 2e-06 ref|XP_007040894.1| RNA-binding (RRM/RBD/RNP motifs) family prot... 56 6e-06 ref|XP_003612528.1| Alkylated DNA repair protein alkB-like prote... 56 6e-06 emb|CBI29214.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002270503.1| PREDICTED: alkylated DNA repair protein alkB... 55 8e-06 >ref|XP_006342480.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Solanum tuberosum] Length = 341 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFTLRKVRKGPC CEFP+YCDSQ+ Sbjct: 315 RRVSFTLRKVRKGPCECEFPEYCDSQK 341 >ref|XP_004253074.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Solanum lycopersicum] Length = 342 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFTLRKVRKGPC CEFP+YCDSQ+ Sbjct: 315 RRVSFTLRKVRKGPCECEFPEYCDSQK 341 >gb|EYU37445.1| hypothetical protein MIMGU_mgv1a009341mg [Mimulus guttatus] Length = 345 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR*VK 275 RRVSFTLRKV KG C+CEFPQYCDSQR VK Sbjct: 316 RRVSFTLRKVLKGACQCEFPQYCDSQRYVK 345 >ref|XP_006494108.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Citrus sinensis] Length = 347 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFT RKVR+GPCRC+FPQYCDSQ+ Sbjct: 321 RRVSFTFRKVREGPCRCKFPQYCDSQK 347 >ref|XP_006432892.1| hypothetical protein CICLE_v10004016mg [Citrus clementina] gi|557535014|gb|ESR46132.1| hypothetical protein CICLE_v10004016mg [Citrus clementina] Length = 868 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFT RKVR+GPCRC+FPQYCDSQ+ Sbjct: 842 RRVSFTFRKVREGPCRCKFPQYCDSQK 868 >ref|XP_007040894.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] gi|590680560|ref|XP_007040895.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] gi|508778139|gb|EOY25395.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] gi|508778140|gb|EOY25396.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] Length = 338 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQ 287 RRVSFT RKVR GPC+CEFPQYCDSQ Sbjct: 312 RRVSFTFRKVRTGPCQCEFPQYCDSQ 337 >ref|XP_003612528.1| Alkylated DNA repair protein alkB-like protein [Medicago truncatula] gi|355513863|gb|AES95486.1| Alkylated DNA repair protein alkB-like protein [Medicago truncatula] Length = 344 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFTLRKVR G C+CEFPQYCDSQR Sbjct: 318 RRVSFTLRKVRAGLCKCEFPQYCDSQR 344 >emb|CBI29214.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFT RKVR GPC+CEFPQYCDS R Sbjct: 886 RRVSFTFRKVRTGPCQCEFPQYCDSPR 912 >ref|XP_002270503.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Vitis vinifera] Length = 349 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -2 Query: 364 RRVSFTLRKVRKGPCRCEFPQYCDSQR 284 RRVSFT RKVR GPC+CEFPQYCDS R Sbjct: 323 RRVSFTFRKVRTGPCQCEFPQYCDSPR 349