BLASTX nr result
ID: Mentha23_contig00041877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041877 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEP03176.1| putative copalyl diphosphate synthase [Isodon eri... 63 5e-08 gb|AEP03175.1| copalyl diphosphate synthase [Isodon eriocalyx] 63 5e-08 >gb|AEP03176.1| putative copalyl diphosphate synthase [Isodon eriocalyx] Length = 787 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +2 Query: 182 EGGDLVEAEARXXXXXXXXXXXXNESSFSHPKYHLLLEATCKVCHQLRL 328 EGG+L EAEA+ +ESSFSHPKYH LLEATCKVC+QLRL Sbjct: 657 EGGNLGEAEAQLLLQTLHLSSGLDESSFSHPKYHQLLEATCKVCNQLRL 705 >gb|AEP03175.1| copalyl diphosphate synthase [Isodon eriocalyx] Length = 794 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +2 Query: 182 EGGDLVEAEARXXXXXXXXXXXXNESSFSHPKYHLLLEATCKVCHQLRL 328 EGG+L EAEA+ +ESSFSHPKYH LLEATCKVC+QLRL Sbjct: 664 EGGNLGEAEAQLLLQTLHLSSGLDESSFSHPKYHQLLEATCKVCNQLRL 712