BLASTX nr result
ID: Mentha23_contig00041831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041831 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20912.1| hypothetical protein MIMGU_mgv1a026493mg [Mimulus... 57 3e-06 >gb|EYU20912.1| hypothetical protein MIMGU_mgv1a026493mg [Mimulus guttatus] Length = 301 Score = 57.0 bits (136), Expect = 3e-06 Identities = 41/138 (29%), Positives = 63/138 (45%), Gaps = 2/138 (1%) Frame = -3 Query: 431 GQSTAWVPVGSRTDYEDVAYSTAHDRFVSMPASYLSELEHTFSGEMDDLEWGSYIIGSAS 252 G+ST W P+GSR + S + S S EL + + S Sbjct: 171 GRSTEWTPIGSRLTNDGFNGSEGVRVYESFVYSATQEL--------------FFCVTENS 216 Query: 251 KLEVWDVTEPTRPSLDGRIGYSNDFADLYLYPWPCRSQDDLKIKEKCWRIKYLVV--HGG 78 E WD+ +P P + I + AD +YP RS+++L +K CWR++ LVV G Sbjct: 217 DFEAWDLRDPHSPVM---IPMDDVSADPEMYPVAHRSREELVMKYMCWRVRSLVVDEKSG 273 Query: 77 DIFVVVRHVNPRMREDGS 24 +F+V+R V + +GS Sbjct: 274 QLFLVIRFVANDVDSNGS 291