BLASTX nr result
ID: Mentha23_contig00041494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041494 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44174.1| hypothetical protein MIMGU_mgv1a006296mg [Mimulus... 72 8e-11 >gb|EYU44174.1| hypothetical protein MIMGU_mgv1a006296mg [Mimulus guttatus] Length = 449 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/64 (54%), Positives = 44/64 (68%) Frame = +1 Query: 163 MNYPNWAEIQQNPNPNSEFSVRHAPNHSGGYSQNVVYDPYQPSNVDPHSALFLPPQPRPP 342 M+Y WAE+QQNPN S + H N+S GYS N DPYQP VDPH+AL+ PQ +PP Sbjct: 1 MDYARWAEMQQNPN--SGVPLLHTVNYSAGYSHNPNSDPYQPPAVDPHNALY-QPQLQPP 57 Query: 343 GVDP 354 G++P Sbjct: 58 GLEP 61