BLASTX nr result
ID: Mentha23_contig00041449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041449 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus... 58 1e-06 >gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus guttatus] Length = 888 Score = 58.2 bits (139), Expect = 1e-06 Identities = 44/116 (37%), Positives = 69/116 (59%), Gaps = 16/116 (13%) Frame = -1 Query: 300 RDFCLSESKKDGFYHV-IGHDS---PQG-ISRQRRVVIPKNTSDKKVLDDLRSMSHVRSI 136 R+ CL E++K+ F +V I HD PQG I+ QRR+ I ++TS+ + L L+SM VRS+ Sbjct: 476 RELCLREAEKEKFLYVRIPHDLNNVPQGVINTQRRIGIHQSTSEPEALYALQSMPLVRSL 535 Query: 135 ISEYGKVPDCENFKLVKLVQN-DESLMNSGAFQY----------VNLRFLAVRVDS 1 I E+ V +F+L+++++ D+ L + QY N RF+A+RVDS Sbjct: 536 ICEFKGVLPTLDFRLLRVLKAVDKHLYSEEKRQYKYPIEVVFRLFNSRFIAIRVDS 591