BLASTX nr result
ID: Mentha23_contig00041420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041420 (558 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Popu... 62 1e-07 >ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] gi|222867445|gb|EEF04576.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] Length = 63 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 543 SRPVSQNIRSGRLRTFALAGLESLCCSILPWMSE 442 S+ VSQNIRSGRLR FA AGLESLCC ILPWMSE Sbjct: 17 SKLVSQNIRSGRLRAFAFAGLESLCCFILPWMSE 50