BLASTX nr result
ID: Mentha23_contig00041380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041380 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348028.1| PREDICTED: putative tRNA pseudouridine synth... 67 2e-09 ref|XP_006348027.1| PREDICTED: putative tRNA pseudouridine synth... 67 2e-09 ref|XP_004247032.1| PREDICTED: putative tRNA pseudouridine synth... 67 3e-09 ref|XP_007017040.1| Pseudouridine synthase family protein [Theob... 66 4e-09 gb|EYU45681.1| hypothetical protein MIMGU_mgv1a004890mg [Mimulus... 64 2e-08 ref|XP_007207376.1| hypothetical protein PRUPE_ppa004352mg [Prun... 61 1e-07 ref|XP_007142071.1| hypothetical protein PHAVU_008G250100g [Phas... 60 3e-07 gb|EXC28455.1| hypothetical protein L484_001536 [Morus notabilis] 60 4e-07 ref|XP_004296032.1| PREDICTED: putative tRNA pseudouridine synth... 60 4e-07 ref|XP_006575439.1| PREDICTED: putative tRNA pseudouridine synth... 57 3e-06 ref|XP_006575435.1| PREDICTED: putative tRNA pseudouridine synth... 57 3e-06 ref|XP_002517735.1| hypothetical protein RCOM_1135690 [Ricinus c... 56 6e-06 ref|XP_002276856.1| PREDICTED: putative tRNA pseudouridine synth... 55 8e-06 >ref|XP_006348028.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X2 [Solanum tuberosum] Length = 423 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESR 127 DPS SPW EWV ILDANTSIP+SQL+ VR +WKLW +SR Sbjct: 381 DPSKSPWSEWVEILDANTSIPDSQLEEVRVAWKLWKAQYDSR 422 >ref|XP_006348027.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X1 [Solanum tuberosum] Length = 487 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESR 127 DPS SPW EWV ILDANTSIP+SQL+ VR +WKLW +SR Sbjct: 445 DPSKSPWSEWVEILDANTSIPDSQLEEVRVAWKLWKAQYDSR 486 >ref|XP_004247032.1| PREDICTED: putative tRNA pseudouridine synthase-like [Solanum lycopersicum] Length = 496 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESRKK 133 DPS SPW EWV ILDANTSIP+ QL+ VR +WKLW +SR K Sbjct: 441 DPSKSPWSEWVEILDANTSIPDYQLEEVRVAWKLWKAQYDSRTK 484 >ref|XP_007017040.1| Pseudouridine synthase family protein [Theobroma cacao] gi|508787403|gb|EOY34659.1| Pseudouridine synthase family protein [Theobroma cacao] Length = 507 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEML 118 DPS SPWKEWV LDANTS+P+++LD VR +WKLW E L Sbjct: 457 DPSKSPWKEWVENLDANTSVPDAELDEVRTAWKLWKEKL 495 >gb|EYU45681.1| hypothetical protein MIMGU_mgv1a004890mg [Mimulus guttatus] Length = 506 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESRKK 133 DP SPW EWV +LDANT IPESQL+ VR++WKLW E +K Sbjct: 460 DPVKSPWNEWVDLLDANTCIPESQLEEVRSAWKLWREEFYGPRK 503 >ref|XP_007207376.1| hypothetical protein PRUPE_ppa004352mg [Prunus persica] gi|462403018|gb|EMJ08575.1| hypothetical protein PRUPE_ppa004352mg [Prunus persica] Length = 515 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLES 124 +PS PWKEWV LD NT IP+++LD VRN+WK+W E +S Sbjct: 468 EPSGYPWKEWVENLDRNTGIPDAELDEVRNAWKVWKEKFDS 508 >ref|XP_007142071.1| hypothetical protein PHAVU_008G250100g [Phaseolus vulgaris] gi|561015204|gb|ESW14065.1| hypothetical protein PHAVU_008G250100g [Phaseolus vulgaris] Length = 507 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESR 127 DPS SPW+EW+ LDA TSIP QLD VR +W L E LESR Sbjct: 460 DPSGSPWEEWIEKLDAYTSIPNDQLDEVRKAWNLLQENLESR 501 >gb|EXC28455.1| hypothetical protein L484_001536 [Morus notabilis] Length = 153 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESR 127 DPS SPW+EWV LD NT IP++QLD VR +W W E ESR Sbjct: 96 DPSASPWREWVENLDHNTRIPDAQLDEVRIAWNTWKENYESR 137 >ref|XP_004296032.1| PREDICTED: putative tRNA pseudouridine synthase-like [Fragaria vesca subsp. vesca] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLES 124 +PS PW+EW+ LD NT IP+ +LD VRN+WK+W E ES Sbjct: 464 EPSGYPWQEWIENLDRNTGIPDRELDEVRNAWKVWKEKFES 504 >ref|XP_006575439.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X5 [Glycine max] Length = 403 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLES 124 DPS SPW EW+ LDA+TSIP QLD VR +W L+ E E+ Sbjct: 357 DPSRSPWDEWIEKLDAHTSIPNDQLDEVRKAWNLFKEKFET 397 >ref|XP_006575435.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X1 [Glycine max] gi|571441413|ref|XP_006575436.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X2 [Glycine max] gi|571441415|ref|XP_006575437.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X3 [Glycine max] gi|571441417|ref|XP_006575438.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X4 [Glycine max] Length = 493 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLES 124 DPS SPW EW+ LDA+TSIP QLD VR +W L+ E E+ Sbjct: 447 DPSRSPWDEWIEKLDAHTSIPNDQLDEVRKAWNLFKEKFET 487 >ref|XP_002517735.1| hypothetical protein RCOM_1135690 [Ricinus communis] gi|223543133|gb|EEF44667.1| hypothetical protein RCOM_1135690 [Ricinus communis] Length = 139 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESRKKM 136 DP SPWK W+ LD TSIP++QL+ VR++W LW E ++R + Sbjct: 89 DPCGSPWKIWIEKLDEYTSIPDAQLEEVRSAWHLWKEKFQTRNSV 133 >ref|XP_002276856.1| PREDICTED: putative tRNA pseudouridine synthase-like [Vitis vinifera] Length = 564 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/71 (39%), Positives = 42/71 (59%) Frame = +2 Query: 2 DPSNSPWKEWVPILDANTSIPESQLDGVRNSWKLWHEMLESRKKMVV*LSN*DAMKKKNV 181 DPS SPW +W+ L + SIPE++LD VR +WKLW E SR K++ Sbjct: 470 DPSKSPWHDWLENLTLS-SIPEAELDDVRTAWKLWKENFRSRTKVM----------SIGF 518 Query: 182 SVIALILFISV 214 S+++ ++F+SV Sbjct: 519 SLVSTLMFLSV 529