BLASTX nr result
ID: Mentha23_contig00041351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041351 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia four... 60 2e-07 gb|EYU45261.1| hypothetical protein MIMGU_mgv1a019713mg [Mimulus... 57 3e-06 >dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri] Length = 71 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/73 (46%), Positives = 44/73 (60%) Frame = +3 Query: 6 MKTKYSSFWFMLLLVFALASQEAEGSPCVSASSTFESVCSTNTAPQCQQACVNEGYTGSF 185 M+TKY F M+LLV AL+S +A GS C S S F+ C +++ CQ C EG+TG Sbjct: 1 MQTKYI-FALMVLLVLALSSHDANGSLCRSPSQKFKGPCFSDS--NCQSVCEGEGFTGGE 57 Query: 186 CGGADGNRCFCTK 224 C G RCFC+K Sbjct: 58 CEGF-RRRCFCSK 69 >gb|EYU45261.1| hypothetical protein MIMGU_mgv1a019713mg [Mimulus guttatus] Length = 71 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/76 (42%), Positives = 46/76 (60%) Frame = +3 Query: 6 MKTKYSSFWFMLLLVFALASQEAEGSPCVSASSTFESVCSTNTAPQCQQACVNEGYTGSF 185 M+TKY F F++LL+ + ASQEA G C S S++++ VC + C+ AC+NEG+ Sbjct: 1 METKYL-FGFVMLLLISFASQEAMGRVCESKSASYKGVCVLDVT--CKLACLNEGFADGD 57 Query: 186 CGGADGNRCFCTKRSC 233 C G RC C +R C Sbjct: 58 CEGV-RRRCMC-RRPC 71