BLASTX nr result
ID: Mentha23_contig00041225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041225 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26180.1| hypothetical protein MIMGU_mgv1a024509mg, partial... 43 4e-06 >gb|EYU26180.1| hypothetical protein MIMGU_mgv1a024509mg, partial [Mimulus guttatus] Length = 651 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -1 Query: 100 YCGDIYVRNAF-HFLAYCAELEAARAVFDESSVR 2 Y GD++V N+ HFL C ELEAA VFDES VR Sbjct: 150 YDGDVFVHNSLIHFLVSCRELEAANKVFDESCVR 183 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 19/50 (38%), Positives = 23/50 (46%) Frame = -2 Query: 237 EAFAMHD*MLVFASSSDVSLRPGNYTXXXXXXXXXXXXLSHLGHAIIAGI 88 E F ++ ML S S V LRP NYT LS LGH I+ + Sbjct: 96 EVFVLYKQMLAVVSYSGVCLRPDNYTFPLLFKTCARFSLSRLGHGILVHV 145