BLASTX nr result
ID: Mentha23_contig00041144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041144 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Mimulus... 83 3e-14 >gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Mimulus guttatus] Length = 313 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +2 Query: 329 MVQQTKDSTFTEYGLAHAESGLSNSDKQLSISIASKRTELLGPHNESPMAVSKSIGS 499 MVQQTKDSTFTEYGLAH +SGLSNSDKQLS + +K +EL NE+PM VSKSIGS Sbjct: 1 MVQQTKDSTFTEYGLAHVQSGLSNSDKQLSEFVPAKTSELQSSCNENPMTVSKSIGS 57