BLASTX nr result
ID: Mentha23_contig00041127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041127 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44153.1| hypothetical protein MIMGU_mgv1a018011mg, partial... 60 3e-07 >gb|EYU44153.1| hypothetical protein MIMGU_mgv1a018011mg, partial [Mimulus guttatus] Length = 420 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 4 ILRGNQGNSKGTLPWFLRGSQESSDLNKTN-GSYFMNLDSLQSCSHEFFKKVEL 162 I + + N LPWFLR SQ S+D++K SYFMN+DSLQ+CS +FFKK E+ Sbjct: 68 ISKNDSENQNRGLPWFLRTSQVSNDMSKEKKSSYFMNMDSLQNCSMDFFKKAEV 121