BLASTX nr result
ID: Mentha23_contig00041081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041081 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC30509.1| hypothetical protein L484_010758 [Morus notabilis] 57 3e-06 ref|XP_006421551.1| hypothetical protein CICLE_v10007144mg [Citr... 57 3e-06 >gb|EXC30509.1| hypothetical protein L484_010758 [Morus notabilis] Length = 698 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 3/105 (2%) Frame = +3 Query: 3 PDIFNNFPWGAYSYKTLKHYVENASGGNKYHLYGPS---WALVVWAFEVVPELADVAATR 173 P++F+N+PWG SY+ Y++ + + YG +A++VWA+E +P L + Sbjct: 264 PELFDNYPWGRLSYEMTIAYIKRSIKSQEAEAYGIGGFPYAVIVWAYETIPTLIKKNIAK 323 Query: 174 DTDNDIPRCLKWIFKKKLLVTNVELRALFEEEGEVPRNIVATDEE 308 N IPR + W ++ + R E EV R I+ + EE Sbjct: 324 RIGNGIPRIINWEADQQPSFREITDRVFDSLELEV-RQIIPSKEE 367 >ref|XP_006421551.1| hypothetical protein CICLE_v10007144mg [Citrus clementina] gi|557523424|gb|ESR34791.1| hypothetical protein CICLE_v10007144mg [Citrus clementina] Length = 531 Score = 56.6 bits (135), Expect = 3e-06 Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 13/99 (13%) Frame = +3 Query: 12 FNNFPWGAYSYK----TLKHYVENASGG---------NKYHLYGPSWALVVWAFEVVPEL 152 FNN+P G S++ +LK+ V S KY LYG +A VW +EV+ E Sbjct: 187 FNNYPCGRLSFEATMLSLKNTVTRRSKRIGSLDPNTEEKYSLYGFPYAFQVWTYEVLSEF 246 Query: 153 ADVAATRDTDNDIPRCLKWIFKKKLLVTNVELRALFEEE 269 + AT D +PR LKW K K++ NV +AL EE+ Sbjct: 247 SQKFATEKGDLKVPRILKWFCKNKIM-ANVINKALKEED 284