BLASTX nr result
ID: Mentha23_contig00041066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041066 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31172.1| hypothetical protein MIMGU_mgv1a003621mg [Mimulus... 84 3e-14 >gb|EYU31172.1| hypothetical protein MIMGU_mgv1a003621mg [Mimulus guttatus] Length = 573 Score = 83.6 bits (205), Expect = 3e-14 Identities = 44/98 (44%), Positives = 63/98 (64%), Gaps = 1/98 (1%) Frame = +3 Query: 27 RLLSQTSRNLRDRRLNLKFFGSILPS-SSGHSFKSLRTYEQFMQDDCFHEKIMSRNVCFS 203 R L +SRNL D+ NLKFF S S S+G +S++T+E +D C+H+ I+SR++CF Sbjct: 4 RRLKHSSRNLVDQLSNLKFFNSSRSSISAGLQSRSIQTFELVKEDVCYHKHIVSRHICFL 63 Query: 204 SQSGVGILGCLTKFQSDGLQTYRRNLASIASTPERNKS 317 SG+GI L QS+ + + RNLAS+A+ P RN S Sbjct: 64 KGSGIGIPASLRGVQSNAFRIHSRNLASVATVPSRNPS 101