BLASTX nr result
ID: Mentha23_contig00041031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00041031 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45075.1| hypothetical protein MIMGU_mgv1a004183mg [Mimulus... 59 5e-07 >gb|EYU45075.1| hypothetical protein MIMGU_mgv1a004183mg [Mimulus guttatus] Length = 540 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = +3 Query: 3 GRCEMRVHICGIGKKGLNYQHG-TKNLPMP 89 G+CEMRVHICGIGKKGLNYQ+G T+NLPMP Sbjct: 511 GKCEMRVHICGIGKKGLNYQNGTTRNLPMP 540