BLASTX nr result
ID: Mentha23_contig00040757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040757 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS35259.1| hypothetical protein H072_11450 [Dactylellina hap... 69 5e-10 gb|EMS25726.1| hypothetical protein RHTO_00154 [Rhodosporidium t... 67 3e-09 gb|EHK97653.1| hypothetical protein M7I_6537 [Glarea lozoyensis ... 66 6e-09 gb|EGX44576.1| hypothetical protein AOL_s00188g244 [Arthrobotrys... 65 8e-09 gb|EMS23676.1| hypothetical protein RHTO_06735 [Rhodosporidium t... 64 2e-08 gb|EME50291.1| hypothetical protein DOTSEDRAFT_20660 [Dothistrom... 62 8e-08 gb|EMS23790.1| hypothetical protein RHTO_06849 [Rhodosporidium t... 62 1e-07 gb|EMC97095.1| hypothetical protein BAUCODRAFT_32838 [Baudoinia ... 62 1e-07 ref|XP_003856926.1| hypothetical protein MYCGRDRAFT_84263 [Zymos... 60 2e-07 gb|EXJ62170.1| hypothetical protein A1O7_02603 [Cladophialophora... 60 3e-07 gb|ETI23963.1| hypothetical protein G647_05770 [Cladophialophora... 60 3e-07 ref|XP_007294342.1| hypothetical protein MBM_06453 [Marssonina b... 59 9e-07 gb|EMF17363.1| hypothetical protein SEPMUDRAFT_138059 [Sphaeruli... 58 1e-06 emb|CCG83808.1| protein of unknown function [Taphrina deformans ... 56 5e-06 ref|XP_001589758.1| predicted protein [Sclerotinia sclerotiorum ... 56 6e-06 >gb|EPS35259.1| hypothetical protein H072_11450 [Dactylellina haptotyla CBS 200.50] Length = 105 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 263 TYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKS 132 TYKP+EH GLK+DGTPDKR++SEHGFGG+D E G+KGG++ Sbjct: 5 TYKPTEHGGLKEDGTPDKRVNSEHGFGGQDREQVSEIGRKGGQT 48 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQEDKE 105 + YKPSEH GLKKDGT D+R S+HGFG + E G+KGG++ G Q++ + Sbjct: 52 DIYKPSEHGGLKKDGTEDQRTRSDHGFGSRPKEEVQEIGRKGGQARGGQQDEDD 105 >gb|EMS25726.1| hypothetical protein RHTO_00154 [Rhodosporidium toruloides NP11] Length = 131 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKS 132 E YKPSEHDGL++DG PD+R++SEHGFGG D EAG+KGGK+ Sbjct: 35 EIYKPSEHDGLREDGEPDQRLNSEHGFGG-DRERAAEAGRKGGKT 78 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQE 114 E YKPSEH GL K G PDKRM+SEHGFGG D E GK+GG + E Sbjct: 82 EVYKPSEHGGLTKSGEPDKRMNSEHGFGG-DREFASEMGKRGGSRNADDDE 131 >gb|EHK97653.1| hypothetical protein M7I_6537 [Glarea lozoyensis 74030] gi|512196851|gb|EPE25687.1| hypothetical protein GLAREA_01599 [Glarea lozoyensis ATCC 20868] Length = 93 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = -2 Query: 281 MSSEGETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGT 123 MSS GETYKP+EH GLK+DGTPDKR+ + G + DP EAGK GG +SGT Sbjct: 1 MSSTGETYKPTEHGGLKEDGTPDKRVGT--GQFAQGKVDPHEAGKSGGATSGT 51 >gb|EGX44576.1| hypothetical protein AOL_s00188g244 [Arthrobotrys oligospora ATCC 24927] Length = 107 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 275 SEGETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKS 132 S G YKP+E++GLK+DGT DKR++SEHGFGG+D E G+KGG++ Sbjct: 2 SSGSKYKPTENNGLKEDGTEDKRVNSEHGFGGQDRDHVSEMGRKGGQT 49 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQ-EDKE 105 E YKPSEH GLK DGT DKR S+HGFG + E G+KGG + G+ Q ED E Sbjct: 53 EIYKPSEHGGLKSDGTEDKRTRSDHGFGSRPTEEVQEIGRKGGLARGSQQGEDYE 107 >gb|EMS23676.1| hypothetical protein RHTO_06735 [Rhodosporidium toruloides NP11] Length = 61 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQE 114 E YKPSEH GLKK+G PDKRM+S HGFGG D E GK+GG +G +E Sbjct: 12 EVYKPSEHGGLKKNGEPDKRMNSGHGFGG-DRERASEMGKRGGAKTGDDEE 61 >gb|EME50291.1| hypothetical protein DOTSEDRAFT_20660 [Dothistroma septosporum NZE10] Length = 84 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = -2 Query: 281 MSSEGETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQEDKE* 102 MSS G+TYKP+EH GL++DG PD R+ + G + DPVEAGK+GG SSG + + Sbjct: 1 MSSGGDTYKPTEHGGLREDGQPDGRVGT--GKFAQGKVDPVEAGKQGGNSSGGGDDSSDN 58 Query: 101 SFG 93 S G Sbjct: 59 SGG 61 >gb|EMS23790.1| hypothetical protein RHTO_06849 [Rhodosporidium toruloides NP11] Length = 68 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQED 111 Y+P EHDG KKDG+PDKR+SSEHGFGG EAGK+GG + QED Sbjct: 20 YRPKEHDGKKKDGSPDKRVSSEHGFGGNKDL-ASEAGKRGGSKT---QED 65 >gb|EMC97095.1| hypothetical protein BAUCODRAFT_32838 [Baudoinia compniacensis UAMH 10762] Length = 81 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQEDKE*SFG 93 YKP+EHDGL+KDG PD R+++ GG+ DPVEAGKKGG SSG D S G Sbjct: 4 YKPTEHDGLRKDGQPDGRVNTGEFAGGK--VDPVEAGKKGGHSSGGDSSDSGSSGG 57 >ref|XP_003856926.1| hypothetical protein MYCGRDRAFT_84263 [Zymoseptoria tritici IPO323] gi|339476811|gb|EGP91902.1| hypothetical protein MYCGRDRAFT_84263 [Zymoseptoria tritici IPO323] Length = 80 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQEDKE 105 YKP+EHDGL+KDG PDKR+ + G + DPVEAGKKGG +SG + E Sbjct: 4 YKPTEHDGLRKDGQPDKRVGT--GEFAQGKVDPVEAGKKGGNTSGGSDDSSE 53 >gb|EXJ62170.1| hypothetical protein A1O7_02603 [Cladophialophora yegresii CBS 114405] Length = 87 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQED 111 YKP+EHDGL+KDG PDKR+ G+ DPVEAGKKGG SSG D Sbjct: 4 YKPTEHDGLRKDGQPDKRVQQTEFAHGK--VDPVEAGKKGGHSSGGGNSD 51 >gb|ETI23963.1| hypothetical protein G647_05770 [Cladophialophora carrionii CBS 160.54] Length = 87 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQED 111 YKP+EHDGL+KDG PDKR+ G+ DPVEAGKKGG SSG D Sbjct: 4 YKPTEHDGLRKDGQPDKRVQQSEFAHGK--VDPVEAGKKGGHSSGGGTSD 51 >ref|XP_007294342.1| hypothetical protein MBM_06453 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862186|gb|EKD15237.1| hypothetical protein MBM_06453 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 85 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSG 126 +TYKP+EH GLK+DGTPDKR+ + G + DP EAG +GGKSSG Sbjct: 3 DTYKPTEHGGLKEDGTPDKRVGT--GQFAQGKVDPAEAGAQGGKSSG 47 >gb|EMF17363.1| hypothetical protein SEPMUDRAFT_138059 [Sphaerulina musiva SO2202] Length = 81 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRMSSEHGFGGEDGPDPVEAGKKGGKSSGTPQEDK 108 YKP+EHDGL+KDG PD+R+ + G + DPVEAGKKGG +SG+ ++ Sbjct: 4 YKPTEHDGLRKDGQPDQRVGT--GEFAQGKVDPVEAGKKGGNTSGSGSSEE 52 >emb|CCG83808.1| protein of unknown function [Taphrina deformans PYCC 5710] Length = 72 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/69 (47%), Positives = 38/69 (55%), Gaps = 25/69 (36%) Frame = -2 Query: 260 YKPSEHDGLKKDGTPDKRM--------------SSEHGFGGEDG-----------PDPVE 156 YKP+EHDGLKKDGTPDKR+ SS++ G G DPVE Sbjct: 4 YKPTEHDGLKKDGTPDKRVAGNQDSTSSSTSTSSSDNSGSGNSGGSKSGEFAHGKVDPVE 63 Query: 155 AGKKGGKSS 129 AGKKGG+SS Sbjct: 64 AGKKGGQSS 72 >ref|XP_001589758.1| predicted protein [Sclerotinia sclerotiorum 1980] gi|154693875|gb|EDN93613.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 94 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 266 ETYKPSEHDGLKKDGTPDKRM-SSEHGFGGEDGPDPVEAGKKGGKSSGTPQEDK 108 + YKP+EH+GLK+DGTPDKR+ + E +G DP EAG KGG+++G+ D+ Sbjct: 3 DKYKPTEHEGLKEDGTPDKRVGTGEFAYG---QVDPHEAGAKGGQATGSSDTDE 53