BLASTX nr result
ID: Mentha23_contig00040713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040713 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214664.1| hypothetical protein PRUPE_ppa003338mg [Prun... 63 5e-08 ref|XP_006362951.1| PREDICTED: plant intracellular Ras-group-rel... 62 6e-08 dbj|BAB02370.1| leucine-rich repeat protein; contains similarity... 62 8e-08 ref|XP_006827793.1| hypothetical protein AMTR_s00009p00266540 [A... 62 8e-08 ref|XP_006299400.1| hypothetical protein CARUB_v10015560mg [Caps... 62 8e-08 ref|NP_001189901.1| leucine-rich repeat-containing protein [Arab... 62 8e-08 ref|XP_002882942.1| leucine-rich repeat family protein [Arabidop... 62 8e-08 emb|CAA76000.1| leucine-rich repeat protein [Arabidopsis thaliana] 62 8e-08 ref|NP_188160.2| leucine-rich repeat-containing protein [Arabido... 62 8e-08 emb|CAA76001.1| leucine-rich repeat protein [Arabidopsis thaliana] 62 8e-08 gb|EYU26395.1| hypothetical protein MIMGU_mgv1a003454mg [Mimulus... 60 2e-07 ref|XP_004291654.1| PREDICTED: leucine-rich repeat-containing pr... 60 2e-07 ref|XP_007021362.1| Leucine-rich repeat (LRR) family protein [Th... 60 3e-07 ref|XP_004248272.1| PREDICTED: leucine-rich repeat-containing pr... 60 3e-07 ref|XP_006406969.1| hypothetical protein EUTSA_v10020366mg [Eutr... 59 5e-07 ref|XP_007021369.1| Leucine-rich repeat (LRR) family protein iso... 59 7e-07 ref|XP_003570490.1| PREDICTED: leucine-rich repeat-containing pr... 59 7e-07 ref|XP_006464726.1| PREDICTED: plant intracellular Ras-group-rel... 59 9e-07 ref|XP_006451917.1| hypothetical protein CICLE_v10007835mg [Citr... 59 9e-07 ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing pr... 59 9e-07 >ref|XP_007214664.1| hypothetical protein PRUPE_ppa003338mg [Prunus persica] gi|462410529|gb|EMJ15863.1| hypothetical protein PRUPE_ppa003338mg [Prunus persica] Length = 584 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 Q L++DGNPLRSIRR +LDRGTKA+LNYLKD+IVE Sbjct: 549 QALRLDGNPLRSIRRTVLDRGTKAVLNYLKDKIVE 583 >ref|XP_006362951.1| PREDICTED: plant intracellular Ras-group-related LRR protein 6-like [Solanum tuberosum] Length = 584 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 QVLK++GNPLRSIRR ILDRGTK +LNYLK+RIVE Sbjct: 549 QVLKLEGNPLRSIRRAILDRGTKGVLNYLKERIVE 583 >dbj|BAB02370.1| leucine-rich repeat protein; contains similarity to elicitor-inducible receptor EIR [Arabidopsis thaliana] Length = 594 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 559 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 591 >ref|XP_006827793.1| hypothetical protein AMTR_s00009p00266540 [Amborella trichopoda] gi|548832413|gb|ERM95209.1| hypothetical protein AMTR_s00009p00266540 [Amborella trichopoda] Length = 585 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 QVL++DGNPLRSIRRPILDRGTKA+L YLKD+I Sbjct: 551 QVLRLDGNPLRSIRRPILDRGTKAVLKYLKDKI 583 >ref|XP_006299400.1| hypothetical protein CARUB_v10015560mg [Capsella rubella] gi|482568109|gb|EOA32298.1| hypothetical protein CARUB_v10015560mg [Capsella rubella] Length = 968 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 933 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 965 >ref|NP_001189901.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332642150|gb|AEE75671.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 590 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 555 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 587 >ref|XP_002882942.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328782|gb|EFH59201.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 584 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 549 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 581 >emb|CAA76000.1| leucine-rich repeat protein [Arabidopsis thaliana] Length = 584 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 549 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 581 >ref|NP_188160.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|21703129|gb|AAM74505.1| AT3g15410/MJK13_7 [Arabidopsis thaliana] gi|24111377|gb|AAN46812.1| At3g15410/MJK13_7 [Arabidopsis thaliana] gi|332642149|gb|AEE75670.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 584 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 549 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 581 >emb|CAA76001.1| leucine-rich repeat protein [Arabidopsis thaliana] Length = 584 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL++DGNPLRSIRRPIL+RGTKA+LNYLKDR+ Sbjct: 549 EVLRLDGNPLRSIRRPILERGTKAVLNYLKDRL 581 >gb|EYU26395.1| hypothetical protein MIMGU_mgv1a003454mg [Mimulus guttatus] Length = 584 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 QVLK++GNPLRSIRR ILDRGTK +L+YLK+RIVE Sbjct: 549 QVLKLEGNPLRSIRRAILDRGTKGVLSYLKERIVE 583 >ref|XP_004291654.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Fragaria vesca subsp. vesca] Length = 599 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 Q L++DGNPLRSIRR +LDRGTKA+L YLKD+IVE Sbjct: 565 QALRLDGNPLRSIRRAVLDRGTKAVLQYLKDKIVE 599 >ref|XP_007021362.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao] gi|508720990|gb|EOY12887.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao] Length = 190 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 QVL++DGNPLRSIRR ILD+GTKA+L YLKD+I+E Sbjct: 155 QVLRLDGNPLRSIRRAILDKGTKAVLKYLKDKILE 189 >ref|XP_004248272.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Solanum lycopersicum] Length = 584 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 QVLK++GNPLRSIRR ILDRGTK +L YLK+RIVE Sbjct: 549 QVLKLEGNPLRSIRRAILDRGTKGVLKYLKERIVE 583 >ref|XP_006406969.1| hypothetical protein EUTSA_v10020366mg [Eutrema salsugineum] gi|557108115|gb|ESQ48422.1| hypothetical protein EUTSA_v10020366mg [Eutrema salsugineum] Length = 586 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 33/33 (100%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 +VL+++GNPLRSIRRPIL+RGTKA+LNYLKD++ Sbjct: 551 EVLRLEGNPLRSIRRPILERGTKAVLNYLKDKL 583 >ref|XP_007021369.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] gi|508720997|gb|EOY12894.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] Length = 584 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 QVL++DGNPLRSIRR ILD+GTKA+L YLKD+I E Sbjct: 549 QVLRLDGNPLRSIRRAILDKGTKAVLKYLKDKIPE 583 >ref|XP_003570490.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Brachypodium distachyon] Length = 586 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRI 236 QVLK+DGNPLRSIRR +LDRGTKA+L YLKD++ Sbjct: 551 QVLKLDGNPLRSIRRTVLDRGTKAVLQYLKDKL 583 >ref|XP_006464726.1| PREDICTED: plant intracellular Ras-group-related LRR protein 6-like [Citrus sinensis] Length = 583 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 Q L++DGNPLRSIRR ILDRGTKA+L YLKD+I E Sbjct: 548 QALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 582 >ref|XP_006451917.1| hypothetical protein CICLE_v10007835mg [Citrus clementina] gi|557555143|gb|ESR65157.1| hypothetical protein CICLE_v10007835mg [Citrus clementina] Length = 583 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 Q L++DGNPLRSIRR ILDRGTKA+L YLKD+I E Sbjct: 548 QALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 582 >ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 1 [Vitis vinifera] Length = 588 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 334 QVLKVDGNPLRSIRRPILDRGTKAILNYLKDRIVE 230 Q L++DGNPLRSIRR ILDRGTKA+L YLKD+I E Sbjct: 553 QALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 587