BLASTX nr result
ID: Mentha23_contig00040555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040555 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 96 5e-18 ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 61 8e-08 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 47 2e-06 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/76 (67%), Positives = 53/76 (69%), Gaps = 9/76 (11%) Frame = -2 Query: 281 LDSRIFCFSGGGEQWCLRCSRCPP-------ERTAH*LAGL--GGPIWRHTENHAFRTER 129 LDSRIFCFSGGGEQ LRC RCPP R LA GGPI RHTENHAFRTER Sbjct: 52 LDSRIFCFSGGGEQCSLRCGRCPPVGPGLLPARKNRSLASRTSGGPIRRHTENHAFRTER 111 Query: 128 NARLPNQNKKGLVGKK 81 NARLP + K GLVGK+ Sbjct: 112 NARLPKKKKNGLVGKR 127 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 299 YACIFSLDSRIFCFSGGGEQWCLRCSRCPP 210 YAC+F LDSRIFCFSGGGEQ LRC RCPP Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP 268 Score = 21.2 bits (43), Expect(2) = 8e-08 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -1 Query: 318 LALDHYLCMY 289 L+LDHY C++ Sbjct: 234 LSLDHYACLF 243 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 208 SGGHLLQRKHHCSPPPEKQKIRES 279 +GGHL QRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES 317 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Frame = +2 Query: 143 RHGFQYVSR*G---PLVRLASERFFRA 214 RH F + + G PLVRLASERFFRA Sbjct: 261 RHFFGPLKKKGNGPPLVRLASERFFRA 287