BLASTX nr result
ID: Mentha23_contig00040378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040378 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43797.1| hypothetical protein MIMGU_mgv1a001818mg [Mimulus... 56 5e-06 >gb|EYU43797.1| hypothetical protein MIMGU_mgv1a001818mg [Mimulus guttatus] Length = 755 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/66 (46%), Positives = 46/66 (69%) Frame = +2 Query: 65 ESQHVSSNTNDLAFGYKEKFSVFSGMGEKKFGSAIKPLESTNHLSTLTSDEKHSGYNSEA 244 ES +SN +D +FG K+KFS FS GEKKFG A+ +ES ++ S S+ +++ Y+S+ Sbjct: 257 ESLRPTSNISD-SFGLKQKFSSFSDSGEKKFG-AVDHMESMSNSSPWISENRYADYSSDT 314 Query: 245 RSSSNH 262 RSSSN+ Sbjct: 315 RSSSNY 320