BLASTX nr result
ID: Mentha23_contig00040341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040341 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32705.1| hypothetical protein MIMGU_mgv1a0196681mg, partia... 68 1e-09 ref|XP_006360938.1| PREDICTED: stress response protein NST1-like... 65 1e-08 gb|EPS64636.1| hypothetical protein M569_10143 [Genlisea aurea] 60 4e-07 >gb|EYU32705.1| hypothetical protein MIMGU_mgv1a0196681mg, partial [Mimulus guttatus] Length = 192 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 224 MTPQPRRKKWTEAEERTLIDKYGDMACDGTLS 319 MTPQPRRKKWTEAEERTLIDKYG+M+CDG+LS Sbjct: 1 MTPQPRRKKWTEAEERTLIDKYGEMSCDGSLS 32 >ref|XP_006360938.1| PREDICTED: stress response protein NST1-like [Solanum tuberosum] Length = 440 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 224 MTPQPRRKKWTEAEERTLIDKYGDMACDGTLS 319 M PQPRRKKWTEAEERTLIDKYG+M CDGTL+ Sbjct: 1 MMPQPRRKKWTEAEERTLIDKYGEMLCDGTLA 32 >gb|EPS64636.1| hypothetical protein M569_10143 [Genlisea aurea] Length = 383 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 224 MTPQPRRKKWTEAEERTLIDKYGDMACDGTLS 319 M PQPRRKKWTEAEERTLI+KY +MA DGTLS Sbjct: 1 MPPQPRRKKWTEAEERTLIEKYWEMASDGTLS 32