BLASTX nr result
ID: Mentha23_contig00040013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040013 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35880.1| hypothetical protein MIMGU_mgv1a001856mg [Mimulus... 63 5e-08 >gb|EYU35880.1| hypothetical protein MIMGU_mgv1a001856mg [Mimulus guttatus] Length = 748 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -1 Query: 161 MVSEAMTPVSSHYTSKGYPNSSGYHPEEIQMVRMASSMTFNGESEGFPPRNHS 3 MVSEA++ V +H+TSK SSGY+ EE Q V+MASS TFNG SE PPR+ S Sbjct: 297 MVSEAISSVPTHFTSKANGYSSGYYREETQAVKMASSKTFNGVSEELPPRHLS 349