BLASTX nr result
ID: Mentha23_contig00039667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00039667 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245897.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 3e-06 >ref|XP_004245897.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Solanum lycopersicum] Length = 714 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +2 Query: 5 NEWSRFYDKLVSRVSEEEVLSHKAYILFYAKKGTAWFS 118 NEW +F D V RV E+ VLS +AY+LFYAK+GTAWFS Sbjct: 419 NEWYKFDDSKVVRVREDYVLSQEAYVLFYAKRGTAWFS 456